KEGG   Canis familiaris (dog): 478836Help
Entry
478836            CDS       T01007                                 

Gene name
COL5A2
Definition
(RefSeq) collagen alpha-2(V) chain isoform X1
  KO
K19721  collagen, type V/XI/XXIV/XXVII, alpha
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    478836 (COL5A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cfa00536]
    478836 (COL5A2)
Glycosaminoglycan binding proteins [BR:cfa00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   478836 (COL5A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen COLFI VWC TILa Amnionless
Motif
Other DBs
NCBI-GeneID: 478836
NCBI-ProteinID: XP_005640450
Ensembl: ENSCAFG00000014837
VGNC: 39478
UniProt: F1PG08
Position
36
AA seq 1499 aa AA seqDB search
MAAACVRASPLLLVAVLVGRCVAVTAQDDGDDEGYGEEIACTQNGQMYLNRDIWKPAPCQ
ICVCDNGAILCDKIQCQDVLECADPVTPPGECCPVCPHTTGGSNTNFGRGRKGQKGEPGL
VPVVTGIRGRPGPAGPPGSQGPRGERGPKGKPGPRGPQGIDGEPGVPGQPGAPGPPGHPS
HPGPDGMSRPFSAQMAGLDEKSGLGSQVGLMPGSVGPVGPRGPQGLQGQQGGVGPTGPPG
EPGEPGPMGPIGARGPEGPPGKPGEDGEPGRNGNPGEVGFAGSPGARGFPGAPGLPGLKG
HRGHKGLEGPKGEVGATGSKGEAGPTGPMGAMGPMGPRGMPGERGRLGPQGAPGQRGTHG
MPGKPGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQRGETGPPGPVGSQGLPG
TVGTDGTPGAKGPTGSPGTSGPPGLAGPPGSPGPQGSTGPPGIRGQPGDPGVPGFKGEAG
PKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGSMGERGAPGNRGFPGSDGLPGPKG
AQGERGPVGSSGPKGSQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPG
PPGSIGIRGQPGSMGLPGPKGSSGDPGKPGEAGNAGVPGQRGAPGKDGEVGPSGPVGPPG
LAGERGEQGPPGPTGFQGLPGPPGPPGEGGKPGDQGVPGDPGAVGPLGPRGERGNPGERG
EPGITGLPGEKGMAGGHGPDGPKGSPGPSGTPGDTGPPGLQGMPGERGIAGTPGPKGDRG
GIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGENG
PTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGSPGPHGPNGVPGLKGGRG
TQGPPGATGFPGSAGRVGPPGPPGAPGPAGPLGEPGKEGPPGLRGDPGSHGRVGDRGPAG
PPGGPGDKGDPGEDGQPGPDGPPGPAGTTGQRGIVGMPGQRGERGMPGLPGPAGTPGKVG
PTGAPGDKGPPGPVGPPGSNGPVGEPGPEGPAGNDGTPGRDGAVGERGDRGDPGPAGLPG
SQGAPGTPGPVGAPGDAGQRGDPGSRGPVGPPGRIGKRGLLGPQGPRGDKGDHGDRGDRG
QKGHRGFTGLQGLPGPPGPNGEQGSAGIPGPFGPRGPPGPVGPSGKEGNPGPLGPIGPPG
VRGSVGEAGPEGPPGEPGPPGPPGPPGHLTAALGDIMGHYDESMPDPLPEFTEDQAAPDD
RNKTDPGVHATLKSLSSQIETMRSPDGSKKHPARTCDDLKLCHSAKQSGEYWIDPNQGSV
EDAIKVYCNMDTGETCISANPSSIPRKTWWASKSSDHKPIWYGLDMNRGSQFVYGDHQSP
NAAITQMTFLRLLSKEASQNITYICKNSVGYMDDQAKNLKKAVVLKGSNDLEIKAEGNVR
FRYIVLHDTCSKRNGNVGKTVFEYRTQNVARLPIVDLAAVDVGSTDQEFGIEIGPVCFV
NT seq 4500 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagcctgcgtgcgggcgagcccgctgctcctcgtcgccgtcctcgtcggccgc
tgcgtggcggtgacagcgcaggacgacggcgacgacgaaggatatggtgaagaaatcgcc
tgcactcagaatggtcagatgtacttaaacagagacatttggaaacctgccccttgccag
atctgtgtctgtgacaatggagccatcctctgtgacaagatacagtgccaggatgtcctt
gaatgtgctgaccctgtaactccccctggagaatgctgtcctgtctgcccacatacaact
ggaggtagcaataccaactttggtagaggaagaaagggacaaaaaggagaaccaggatta
gtgcctgttgtaacaggcatacgtggccgtccaggaccagccggacctccaggatcacaa
ggaccaagaggagagaggggcccaaaaggaaagcctggtcctcgtggtcctcagggaatt
gatggagaacccggggttcctggtcaacctggtgccccagggccccccggacatccatcc
cacccagggcctgatggcatgagcaggccattttcagctcagatggctgggttagatgag
aaatctggacttgggagtcaagtaggactcatgcctggctctgtgggtcctgttggccca
agaggacctcaaggcttacaagggcagcaaggtggtgttggccctacaggacctcctggt
gaacccggtgaacctggaccaatgggtccaattggagcacgtggaccagagggtcctcct
ggaaaacccggtgaagatggtgaacctggtagaaatggaaatcctggtgaagtgggattt
gcaggatctccaggagctcgaggatttcctggggctcctggtcttccaggcctgaagggt
caccgaggacacaaaggtcttgaaggccctaaaggtgaagttggggcaacgggttccaag
ggtgaagctggccctactggtccaatgggtgccatgggtccaatgggcccaaggggaatg
ccaggagaaagggggagacttgggccacagggggctcctggacaacgaggcacacatggt
atgcctggaaaacctgggccaatgggtcctcttgggatacctggatcatctggttttcca
ggaaatcctgggatgaagggagaagcaggtcccactggagcaagaggccccgaaggtccc
cagggtcaaagaggtgaaactgggccaccaggcccagttggctctcaaggtcttcctggt
acagtaggaactgatggtacacctggtgccaaaggcccaacgggctctccgggtacctcc
ggtcctcctggtttggcagggccacctggatctccagggcctcagggtagcacgggacct
ccaggaattcgaggccaaccgggcgatccaggagttccgggtttcaaaggagaagctggc
ccaaaaggggaaccagggccacatggtattcagggtccaataggcccacctggtgaagaa
ggcaagagaggtccccgaggtgatccaggaacagtcggtcctccaggctccatgggagaa
aggggtgctcctggcaatcgtggttttccaggctctgatggcttaccgggaccgaagggg
gctcaaggagagaggggtcctgtaggttcttcaggacctaaaggaagtcagggggatcca
ggacggccaggcgaacctgggcttccaggtgctcggggtctgacaggaaatcctggtgtt
caaggtcctgaaggaaaacttgggcctttgggtgctccaggggaggatggccggccaggc
cctccaggctccataggaatcagagggcagccgggaagcatgggtcttccaggccccaaa
ggtagcagtggtgaccctggaaaacctggagaggcgggaaatgctggtgttcctgggcag
aggggagctcctggaaaagatggtgaagtcggtccttctggtcctgtgggccccccgggt
ctcgctggggagagaggagagcagggacctccagggcccactggctttcaggggcttcct
ggtcctccagggccccctggggaagggggaaagccaggtgaccagggagttcctggagat
cctggagcagttggcccattaggacctagaggagaacgcggaaacccgggggagagagga
gaaccaggaataaccggactccctggggagaagggaatggctggaggccacggccctgac
ggcccaaaaggcagtccaggaccatctgggacccctggagacacaggcccaccaggtctt
caaggtatgccaggagaaagaggaattgcaggaactcctggccccaagggtgacagaggt
ggcataggagagaagggtgctgaaggaacagctggaaatgatggagcaagaggtcttccc
ggccccttgggtcctccaggtcctgcaggtcccactggagaaaagggtgaacctggccct
cgaggtttagttggccctcctggctcccgtggcaatcccggttctcgtggtgaaaatggc
ccaaccggggctgttggttttgctggacctcagggtcccgatgggcagcctggagtgaaa
ggtgagcctggcgagccagggcagaagggagatgctggctctcctggaccacaaggtcta
gcagggtccccgggacctcatggtcctaatggtgttcctggactcaaaggtggccgagga
actcagggtccacctggtgcaacagggtttcctggttctgccggcagagttggacctcca
ggccctcctggagctccgggacctgcggggcccctaggggaacctgggaaggagggacct
ccaggtcttcgtggggaccccggctctcatgggcgagtgggagatcgaggaccagctggc
ccccctggtggcccaggagacaaaggagacccaggagaagatgggcaacctggtccagat
ggcccccctggtccagcaggcactactggacagagaggaattgtgggcatgccagggcag
cgtggggagcgaggcatgcctggcttgccaggcccagcgggcacaccaggaaaagtagga
cctaccggcgcaccaggagataaaggtccgcctggacctgtgggacccccaggctcaaat
ggccccgtaggggagcctggccctgaaggtccagctggtaacgatggtactccgggacgg
gacggtgctgttggggaacgtggtgatcgtggagacccgggacctgcaggtctgccgggc
tctcagggtgcccctggaaccccgggccctgtcggtgctccaggagatgcaggacaaaga
ggagatccgggttctcggggccctgtaggaccacctggtcgaatcggaaaacgtggctta
cttggaccccaaggacctcgaggtgacaaaggtgatcatggagaccgaggtgaccgaggt
cagaagggccacagaggcttcactggtcttcagggtcttcccggacctcctggtcccaat
ggtgaacaaggcagcgctgggattcctggaccatttggcccaagaggtcctccaggtcca
gttggtccctcaggtaaagaaggaaaccctggaccacttgggcctatcgggcctcctggt
gtgcggggcagtgtcggagaagcaggacctgagggtcctcctggtgagcccggtccccct
ggccccccggggccccctggccatcttacagctgctcttggagacatcatgggccactac
gatgagagcatgccagacccactgccagagttcactgaggaccaggctgctcccgatgac
agaaacaagactgacccaggggtccatgcaaccctgaagtcactcagtagtcagattgaa
accatgcgcagtcctgacggctctaagaagcacccggcccggacttgtgatgacctaaaa
ctttgccattctgccaagcagagcggtgagtactggattgatcctaaccagggatctgtt
gaagacgcgatcaaagtttactgcaacatggacacaggagaaacatgtatttcagcaaac
ccatccagcataccacgtaaaacctggtgggccagcaaatcttccgaccataagcctatt
tggtatggtctcgacatgaatagaggatctcagtttgtttacggagaccatcagtcacct
aatgcagccattactcaaatgaccttcttgcgccttttatcaaaagaagcctcccagaac
attacttacatctgcaaaaacagtgtgggatacatggacgatcaagccaagaacctcaag
aaagctgtggttctcaaagggtcaaatgacttggaaatcaaggcggaaggaaatgtcaga
ttccgatatattgttcttcatgacacttgctctaaacgaaatggaaatgtgggcaagacc
gtcttcgagtacagaacgcagaatgtggcgcgcttacccatcgtagatcttgccgctgtg
gatgttggcagcacagaccaagaatttggcattgaaatcgggccagtttgttttgtgtag

DBGET integrated database retrieval system