KEGG   Canis familiaris (dog): 478866Help
Entry
478866            CDS       T01007                                 

Gene name
CLK1
Definition
(RefSeq) dual specificity protein kinase CLK1 isoform X1
  KO
K08823  CDC-like kinase [EC:2.7.12.1]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     478866 (CLK1)
Protein kinases [BR:cfa01001]
 Serine/threonine kinases: CMGC group
  CLK family
   478866 (CLK1)
Spliceosome [BR:cfa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    478866 (CLK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 478866
NCBI-ProteinID: XP_005640570
Ensembl: ENSCAFG00000011929
VGNC: 39346
Position
37
AA seq 484 aa AA seqDB search
MRHSKRTYCPDWDEKDWDCGKWRSSSSHKRRKRSHSSARENKRCKYNHSKTSDSHYLESR
SINEKDYHSRRYIDEYRNDYSQGCEPGHRHRDHESRYQNHSSKSSGRSGRSSYKSKHRNH
HSTSHHRSHGKSHRRKRTRSVEDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVECID
HKAGGRHVAVKIVKNVDRYCEAARSEIQVLEHLNTTDPSSTFRCVQMLEWFEHHGHICIV
FELLGLSTYDFIKENGFLPFRLDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVQSD
YTEAYNPKMKRDERTLINADIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPC
DVWSIGCILIEYYLGFTVFPTHDSKEHLAMMERILGPLPKHMIQKTRKRKYFHHDRLDWD
EHSSAGRYVSRRCKPLKEFMLSQDAEHELLFDLIEKMLEYDPAKRITLKEALKHPFFYPL
KKAT
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagacactcaaagagaacttattgtcctgactgggatgaaaaagattgggactgcgga
aaatggagaagcagcagcagtcataaaagaaggaagagatcacatagcagtgcgcgggag
aacaagcgctgcaaatataatcactctaaaacatctgatagccattatttggaaagtaga
tccataaatgagaaagattatcatagtcgacgctacattgatgaatacagaaatgactac
agtcaaggatgtgaacctggacatcgccatagagaccatgaaagcagatatcagaaccat
agtagcaagtcttctgggagaagtggaagaagtagttataaaagcaaacacaggaatcac
catagtacttcacaccatcgttcacatgggaagagtcaccgaaggaaaagaaccaggagt
gtagaggatgatgaggagggtcacctgatctgtcagagtggagacgtactaagtgcaaga
tatgaaattgttgatactttaggagaaggagcttttggaaaagtcgtggagtgcattgat
cataaagcaggaggtagacatgtagcagtaaaaatagttaaaaatgtggatagatactgt
gaagctgctcgctcagaaatacaagttctggaacacttgaatacaacagaccccagcagt
acattccgctgtgtccagatgttggagtggtttgaacatcatggtcacatttgcattgtg
tttgaactactaggacttagtacttacgacttcattaaagaaaatggttttctgccgttt
cgtctggatcatatcaggaagatggcatatcagatatgcaagtcagtgaattttctgcac
agtaacaagttgactcacacagacttaaagcctgaaaacatcttatttgtgcagtctgac
tacacagaggcatataatcccaaaatgaaacgtgatgaacgaaccttaataaatgcagat
attaaagttgtagactttggaagtgcaacctatgatgatgaacatcacagtaccttggta
tctacaagacattatagggcgcctgaagttattttggccctaggatggtcccagccatgt
gatgtctggagtataggatgcattctcattgaatactaccttgggtttacagtatttcca
acacatgatagtaaggagcatttggcaatgatggaaaggattcttggacctttaccaaaa
catatgatacagaaaaccaggaaacgtaaatatttccatcatgatcgattagactgggat
gaacacagttctgctggcagatatgtttcacggcgctgtaaacctctgaaggaatttatg
ctctctcaggatgctgaacatgagcttctctttgacctcatcgagaaaatgttggagtat
gatccagctaaaaggattactctcaaagaagccttaaagcatcctttcttttacccccta
aaaaaagctacatag

DBGET integrated database retrieval system