KEGG   Canis familiaris (dog): 478874Help
Entry
478874            CDS       T01007                                 

Gene name
SUMO1
Definition
(RefSeq) small ubiquitin-related modifier 1
  KO
K12160  small ubiquitin-related modifier
Organism
cfa  Canis familiaris (dog)
Pathway
cfa03013  RNA transport
cfa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    478874 (SUMO1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    478874 (SUMO1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cfa03019]
    478874 (SUMO1)
   04121 Ubiquitin system [BR:cfa04121]
    478874 (SUMO1)
   03029 Mitochondrial biogenesis [BR:cfa03029]
    478874 (SUMO1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cfa04812]
    478874 (SUMO1)
Messenger RNA biogenesis [BR:cfa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     478874 (SUMO1)
Ubiquitin system [BR:cfa04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   478874 (SUMO1)
Mitochondrial biogenesis [BR:cfa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    478874 (SUMO1)
Cytoskeleton proteins [BR:cfa04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    478874 (SUMO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad60-SLD ubiquitin
Motif
Other DBs
NCBI-GeneID: 478874
NCBI-ProteinID: NP_001239192
Ensembl: ENSCAFG00000012431
UniProt: E2RR10
Position
37
AA seq 101 aa AA seqDB search
MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMN
SLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTI
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccaggaggcaaaaccttcaactgaggacttgggggataagaaggaaggagaa
tacattaaactcaaagtcattggacaggatagcagtgagattcacttcaaagtgaaaatg
acaacacatctcaagaaactcaaagaatcatactgtcaaagacagggagttccaatgaat
tcactcaggtttctctttgaaggtcagagaattgctgataatcacactccaaaagaactg
ggaatggaggaagaagatgtgattgaagtttatcaggaacaaacagggggtcattcaacg
atttag

DBGET integrated database retrieval system