KEGG   Canis familiaris (dog): 478914Help
Entry
478914            CDS       T01007                                 

Gene name
ABCB6
Definition
(RefSeq) ATP-binding cassette sub-family B member 6, mitochondrial
  KO
K05661  ATP-binding cassette, subfamily B (MDR/TAP), member 6
Organism
cfa  Canis familiaris (dog)
Pathway
cfa02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    478914 (ABCB6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cfa02000]
    478914 (ABCB6)
Transporters [BR:cfa02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB6, 7 subgroups
    478914 (ABCB6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MTABC_N ABC_tran ABC_membrane SMC_N AAA_16 RsgA_GTPase AAA_22 AAA_29 AAA_21 AAA AAA_24 AAA_30 MMR_HSR1 AAA_33 Zeta_toxin
Motif
Other DBs
NCBI-GeneID: 478914
NCBI-ProteinID: XP_005640740
Ensembl: ENSCAFG00000015130
VGNC: 49115
Position
37
AA seq 842 aa AA seqDB search
MVTVGNYCEAEGPAGPAWVKGGLSPCFFYTLVPSILMGLGALALVLALPCKRRERPTGAH
ERSWTAGPLVAPYVLQLLLATLQVALPLASLVGRVGTAGGAPLPGYLLLASILGTLASAC
GLGLLVVEHNQAWQKLAMGIWIEFRHSAGLLLLWTVAFTAENLALVSWNSPQWWWARADL
GQQVQFSLWVLRYVVSGGLFILGLWAPGLRPQSYALKVNEEDQDVERSEVQTTEAPPRST
WRDLGRKLRLLSGYLWPRGSPVLQLVVLICLGLMGLERGLNVLVPIFYRNIVNSLTEKAP
WNSLAWIVTTYVALKFLQGGGTGSTGFVSNLRTFLWIRVQQFTSRQVELRLFSHLHELSL
RWHLGRRTGEVLRIVDRGTSSVTGLLSYLVFNIIPTLADITIGIIYFSMFFNAWFGLIVF
LCMSLYLIMTIVVTEWRTKFRRAMNTQENATRARAVDSLLNFETVKYYNAEGYEVNCYRE
AITKYQDLEWKSSASLVLLNQTQNLVIGLGLLAGSLLCAYFVSEQKLQVGDFVLFGTYII
QLYMPLNWFGTYYRMIQTNFIDMENMFDLLKEKPEVKDLPGAGPLRFQRGQIEFENVHFS
YANGRETLQDVSFTVMPGQTVALVGPSGAGKSTVLRLLFRFYDISSGCIRIDGQDISQVT
QISLRSHIGVVPQDTVLFNDTIANNIRYGCITAGDEEVMAAAQAAGIHEAIMSFPEGYET
QVGERGLKLSGGEKQRVAIARTILKAPDIILLDEATSALDTSNERAIQASLAKVCANRTT
IVVAHRLSTVVDADQILVFKDGWIVERGRHEALLSRGGMYADMWQLQQRGQEEVSEDTKP
LD
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atggtgactgtgggcaactactgcgaggccgaggggcccgcggggccggcctgggtgaag
ggtggcctgagcccctgcttcttctacacgctcgtgccctccatactgatgggcctgggg
gctctggccttggtgctggcccttccctgcaagcgtcgcgagcggcccactggcgcccac
gagcgctcttggaccgccggccctcttgtcgctccctacgtgctgcagttgctcctggcc
acgcttcaggtggcgctgcccctggccagcctggtcggccgggtgggcactgccgggggc
gccccgctgccaggctacctgctgctggcttccatcctggggactctggccagcgcctgt
ggcctggggctgctcgtggtggagcataaccaggcctggcagaaactagcaatgggcatc
tggatcgagttcaggcacagcgcgggtctcctgctcctctggactgtggcgtttacagct
gagaacttggccctcgtgtcttggaacagcccacagtggtggtgggcaagggcagacttg
ggccagcaggttcagtttagcctctgggtgctgcgatatgtggtttctggagggcttttt
atcctgggactctgggcccctggacttcgtccccagtcctatgccctgaaggttaatgaa
gaggatcaagatgtagagaggagcgaggttcagacaacagaggcacccccaagatctacc
tggcgagaccttggcaggaagctccgcctgctgagtggctacctgtggcctcgagggagt
ccagttctgcagcttgtcgtgctcatctgcctggggctcatggggttggaacggggactg
aatgtgttggtccccatattctataggaacatagtgaactcactgaccgagaaggcacct
tggaactccctggcctggattgttaccacctatgttgccctcaagttcctccaggggggt
ggcactggcagtacaggctttgtgagcaacctgcgcacgttcctatggatccgggtacag
cagttcacatcacggcaggtggagctgcgcctcttctcccacctgcacgagctctctctg
cgctggcacctggggcgccgcacaggggaggtgctgcggatcgtggaccggggcacatcc
agtgtcacagggctgctcagctacctggtgttcaacatcatccccacactggctgacatc
accattggcatcatctacttcagcatgttcttcaatgcctggtttggcctcattgtgttc
ctgtgcatgagtctttacctcatcatgaccattgtggtcactgaatggagaacgaagttt
cgacgtgctatgaacacacaggagaatgctacccgggcacgagctgtggactctttgcta
aacttcgagacggtgaagtattacaacgcggaaggttatgaagtgaactgctatcgagag
gccatcaccaaatatcaggatttggagtggaagtcaagtgcttcactggttttactaaat
cagacccagaacctggtgattggacttgggctccttgctggctctctgctttgtgcatac
tttgtcagcgagcagaagctacaggtcggggactttgtgctgtttggcacctacatcatc
cagctgtacatgcccctcaactggtttggcacctactacaggatgatccagacaaacttc
atcgacatggagaacatgtttgacctgctgaaagagaagccagaagtgaaggacctccct
ggagcagggcccctgcgcttccagaggggccagattgagtttgagaacgtgcacttcagc
tatgcgaatgggcgggaaaccctgcaggatgtgtccttcaccgtcatgcctggacagaca
gtggccctggtgggcccatctggagcggggaagagcacagtattgcgcctgctgtttcgc
ttctatgatatcagctctggctgcatccggatagatgggcaggacatctcccaggtgacc
cagatctccctccggtctcacattggagttgtgccccaagacaccgtcctcttcaatgac
accatcgccaacaatatccgctacggctgcattacagccggggacgaggaggtgatggct
gctgctcaggctgcaggcatccatgaggccattatgagtttccctgaaggttatgagacg
caggtgggcgagcggggactgaagttgagtggtggggagaagcagcgtgtcgccattgct
cgcaccattctcaaggctccagacatcattctgctggatgaggcaacatcagcgctggat
acgtctaacgagagggccatccaggcttctctggccaaagtctgtgccaaccgcaccacc
atcgtagtggcccacaggctctcaaccgtggttgatgctgaccagatccttgtctttaag
gacggctggatcgtggagagaggacggcacgaggctctgttgtcccgaggtggcatgtat
gctgacatgtggcagctgcagcagcggggacaggaagaagtctctgaagacaccaaaccc
ctggactga

DBGET integrated database retrieval system