KEGG   Canis lupus familiaris (dog): 479068
Entry
479068            CDS       T01007                                 

Gene name
WDR61
Definition
(RefSeq) WD repeat-containing protein 61
  KO
K12602  WD repeat-containing protein 61
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    479068 (WDR61)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cfa03019]
    479068 (WDR61)
Messenger RNA biogenesis [BR:cfa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Ski complex
     479068 (WDR61)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Ge1_WD40 Nup160 HPS3_N GSDH Frtz WD40_like Nucleoporin_N DUF2415
Other DBs
NCBI-GeneID: 479068
NCBI-ProteinID: XP_536215
Ensembl: ENSCAFG00000014230
UniProt: E2RBV0
Position
3
AA seq 305 aa
MTNQYSILFKQEQAHDDAIWSVAWGTNKKENSETVVTGSLDDLVKVWKWCDERLDLQWSL
EGHQLGVVSVDISHTLPIAASSSLDAHIRLWDLDNGKQIKSIDAGPVDAWTLAFSPDSQY
LATGTHVGKVNIFGVESGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATG
KLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNVAF
CPDDTHFVSSSSDKSVKVWDVGTRTCVHTFFDHQDQVWGVKYNGNGSKIVSVGDDQEIHV
YDCPV
NT seq 918 nt   +upstreamnt  +downstreamnt
atgaccaaccagtacagtattctcttcaaacaagaacaagcccatgatgatgccatttgg
tcagttgcctgggggactaacaagaaagaaaactctgagacggtggttacggggtccctg
gatgacctggtgaaagtctggaagtggtgtgatgagaggctggacctacagtggagtcta
gagggacatcaactgggcgtggtgtctgtggacatcagccatacgctgcccatcgctgca
tccagttctcttgacgctcatattcgtctctgggacttggataatggcaaacagataaaa
tctatagatgcaggaccagtggatgcctggactttggccttttctcctgattcccagtat
ctggccacaggaactcatgtggggaaagtgaacatttttggtgtggaaagtgggaaaaag
gaatattctctggacacgagaggaaaattcattcttagtattgcatatagccctgatggg
aagtatctggccagtggagccatagatgggatcatcaatatttttgatattgcaactgga
aaacttctgcacacgctggaaggccatgctatgcctatccgttccctgacattctccccg
gattctcagctcctggtcactgcatcagatgatggctacatcaagatctatgatgtacaa
catgccaatttggctggcacgctgagtggccatgcatcatgggtgctgaatgttgcattt
tgtcctgacgacacccactttgtgtccagttcatctgataaaagtgtgaaagtttgggat
gttggaacaagaacctgtgttcacaccttcttcgatcaccaggatcaggtctggggagta
aaatacaatggaaatggctcaaagattgtgtccgtgggcgatgaccaggaaatccacgtc
tatgattgccccgtgtaa

DBGET integrated database retrieval system