KEGG   Canis familiaris (dog): 479466
Entry
479466            CDS       T01007                                 

Gene name
FBXO39
Definition
(RefSeq) F-box only protein 39
  KO
K10314  F-box protein 39
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cfa04121]
    479466 (FBXO39)
Ubiquitin system [BR:cfa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     479466 (FBXO39)
SSDB
Motif
Pfam: F-box-like F-box F-box_5
Other DBs
NCBI-GeneID: 479466
NCBI-ProteinID: XP_536603
Ensembl: ENSCAFG00000015305
VGNC: 40778
UniProt: E2RJW3
Position
5
AA seq 443 aa
MDEESPPVQPPDQSCWANLPDVCLRRVFWWLGDRDRSRAALVCRKWNQIMYSADLWRYRT
ITFSGRPSRVHASEFESALWYVKKFGRYLEHLEIKFLNPYNAVLTKKFQVTMRGLLSCLG
KSNNRLKSLSIQHLELDRLVWRNSIRSSFIKSLGFFLKKVGKHLDYLNLKGARLTVEQGC
VVLTSLSYLRSESVVSQLNIEDFFSHHLAVYSSPQFNKTMATFRSLVSLTLNYNCISDEL
LENLCENNAGTLWTMNIKCHIHDPHGQVIWGMSWAKLARHASNLKVNFFFERVMKYERLA
RILLQEIPIRSISLRSCYFSDPDWSMRPTLTDLLPTFRNTLQKLTFEFNNNHESLDEELH
LLVLSCRKLFYFKIWAFLDVKFVERILKSQEEGQCSLRTLKVRIYTNRYETNDEDRTLRE
IHRKYRKLIDAELNYFVIAYPMM
NT seq 1332 nt   +upstreamnt  +downstreamnt
atggacgaagagagcccgccggtgcagcccccagaccagagctgctgggccaatctgccc
gatgtgtgcctgcgccgtgtcttctggtggctgggagacagggaccggtccagagctgcc
ctggtctgcaggaagtggaaccagattatgtactcggcggacctgtggcgttataggacc
atcacgttcagcgggagaccttccagggtgcatgcttctgaattcgagtcagctctttgg
tatgtcaagaaatttggtcgttatctggaacacctagagatcaaatttctgaacccctac
aatgctgtgttgaccaagaagttccaggtcaccatgcggggcctcctgtcgtgtctgggc
aagagtaacaaccggctcaagtccctgtccatccagcacctggagctggaccgccttgtc
tggaggaacagtatccggagctccttcatcaaaagcctgggcttcttcttaaagaaggtg
ggcaaacacctggattacctcaacctcaagggggccaggctgaccgtggagcagggctgc
gtggtgctcacctcactgagctacttgcggagcgagagcgtggtgtcacagctcaacatc
gaagacttcttcagccaccacctcgctgtctacagcagcccacagttcaacaagaccatg
gccaccttccgcagcctggtgtccctcacgctcaactacaactgcatctccgacgagctg
ctggagaacctgtgtgagaacaatgctggcaccctctggaccatgaacatcaagtgccac
atccacgacccccatgggcaggtcatctggggcatgtcctgggccaagctggccaggcac
gcctccaacctcaaggtcaacttcttcttcgagcgagtcatgaagtatgagcgcctggca
cggatcctcttgcaggagatccccatccggagcatcagtctgaggagctgctactttagc
gacccagactggtccatgaggcccacgctgacagatctcctgcccaccttccggaacact
ctgcagaaactaacatttgagttcaataacaaccacgagtcgctggacgaggagctgcac
ctcctggtcttgtcctgtcgaaagctgttctacttcaagatctgggcttttcttgacgtc
aagtttgtggagcggatcctgaagagtcaggaggaagggcagtgctccctgcgcactctc
aaggtgagaatttacacaaaccgatacgagacaaatgacgaggacaggacgctgcgcgag
atccacaggaagtaccgaaagctcatcgatgcggagctcaactacttcgtcatcgcgtac
cccatgatgtag

DBGET integrated database retrieval system