KEGG   Canis lupus familiaris (dog): 479513
Entry
479513            CDS       T01007                                 

Gene name
UBB
Definition
(RefSeq) polyubiquitin-B
  KO
K04551  ubiquitin B
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04120  Ubiquitin mediated proteolysis
cfa04137  Mitophagy - animal
cfa05012  Parkinson disease
cfa05022  Pathways of neurodegeneration - multiple diseases
cfa05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    479513 (UBB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    479513 (UBB)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    479513 (UBB)
   05022 Pathways of neurodegeneration - multiple diseases
    479513 (UBB)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    479513 (UBB)
Ubiquitin system [BR:cfa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   479513 (UBB)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   479513 (UBB)
  Exosomal proteins of other body fluids (saliva and urine)
   479513 (UBB)
  Exosomal proteins of colorectal cancer cells
   479513 (UBB)
  Exosomal proteins of bladder cancer cells
   479513 (UBB)
SSDB
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 Ubiquitin_5 DUF2407
Other DBs
NCBI-GeneID: 479513
NCBI-ProteinID: XP_013969094
Ensembl: ENSCAFG00000023443
VGNC: 49560
UniProt: F1PDG4
Position
5
AA seq 229 aa
MPIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC
NT seq 690 nt   +upstreamnt  +downstreamnt
atgccgatcttcgtgaaaaccctaaccggcaagaccatcaccctggaggtggagcccagt
gacaccatcgaaaatgtgaaggccaagatccaggataaagagggcatcccgcctgaccag
cagaggctcatctttgcaggcaagcagctggaagatggccgcactctttctgattacaac
atccagaaagagtcaactctccacctggtcctgcgcctgaggggtggtatgcagatcttc
gtgaagaccctgaccggcaagaccatcaccctggaggtggagcccagtgacaccatcgaa
aatgtgaaggccaagatccaggataaagagggcatcccgcctgaccagcagaggctcatc
tttgcaggcaagcagctggaagatggccgcactctttctgattacaacatccagaaagag
tcaactctccacctggtcctgcgcctgaggggtggtatgcagatcttcgtgaagaccctg
accggcaagaccatcaccctggaggtggagcccagtgacaccatcgaaaatgtgaaggcc
aagatccaggataaagagggcatcccgcctgaccagcagaggctcatctttgcaggcaag
cagctggaagatggccgcactctttctgattacaacatccagaaagagtcaactctccac
ctggtcctgcgcctgaggggtggctgttaa

DBGET integrated database retrieval system