KEGG   Canis lupus familiaris (dog): 479730
Entry
479730            CDS       T01007                                 

Gene name
PLOD3
Definition
(RefSeq) procollagen-lysine,2-oxoglutarate 5-dioxygenase 3
  KO
K13646  lysyl hydroxylase/galactosyltransferase/glucosyltransferase [EC:1.14.11.4 2.4.1.50 2.4.1.66]
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa00310  Lysine degradation
cfa00514  Other types of O-glycan biosynthesis
cfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    479730 (PLOD3)
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    479730 (PLOD3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cfa01003]
    479730 (PLOD3)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.4  procollagen-lysine 5-dioxygenase
     479730 (PLOD3)
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     479730 (PLOD3)
    2.4.1.66  procollagen glucosyltransferase
     479730 (PLOD3)
Glycosyltransferases [BR:cfa01003]
 O-Glycan biosynthesis
  O-linked Gal type
   479730 (PLOD3)
SSDB
Motif
Pfam: 2OG-FeII_Oxy 2OG-FeII_Oxy_3 Glyco_tranf_2_3
Other DBs
NCBI-GeneID: 479730
NCBI-ProteinID: XP_536856
Ensembl: ENSCAFG00000013860
VGNC: 44703
UniProt: E2RTL4
Position
6
AA seq 740 aa
MASSGPGLRLLLGLLLLLPPPPATSASDRPRGGDPVNPEKLLVITVATAETEGYRRFLWS
AEFFNYTVRTLGLGEEWRGGDVARTVGGGQKVRWLKKEMEKYADREDMVIMFVDSYDVIL
AGSPAELLKKFVQSGSRLLFSAEGFCWPEWGLAEQYPEVGTGKRFLNSGGFIGFAPTIHK
VVRQWKYKDDDDDQLFYTRLYLDPGLREKLSLNLDHKSRIFQNLNGALDEVVLKFDRNRV
RIRNVAYDTLPVVVHGNGPTKLHLNYLGNYVPNGWTPQGGCGFCGRDRRTLPGGQPPPRV
LLAVFVEQPTPFLPRFLQRLLLLDYPPDRVTLFLHNNEVYHEPHIADSWPQLQDHFSAVK
LVGPEEALTPGEARDMAMDSCRQDPECEFYFSLDADAVITNPQTLRILIEENRKVIAPML
SRHGKLWSNFWGALSPDEYYARSEDYVELVQRKRVGVWNVPYISQAYVIRGETLRTELPQ
REVFSGSDTDPDMAFCKSLRDKGIFLHLSNQHEFGRLLATSRYDTDHLHPDLWQIFDNPL
DWKEQYIHENYSRALEGEGLVEQPCPDVYWFPLLSDQMCDELVEEMEHYGQWSGGRHEDS
RLAGGYENVPTVDIHMKQVGYEDQWLQLLRTYVGPMTESLFPGYHTKTRAVMNFVVRYRP
DEQPSLRPHHDSSTFTLNVALNHKGLDYEGGGCRFLRYDCIVSSPRKGWGLLHPGRLTHY
HEGLPTTRGTRYIMVSFVDP
NT seq 2223 nt   +upstreamnt  +downstreamnt
atggcctcctccggcccgggactccggctcctcctggggctcctactgctgctgccgccg
ccgcctgctacctcggcctccgaccgtccccggggcggcgacccggtcaacccagagaag
ctgctggtgatcacggtggccacagccgagacggaaggataccggcgtttcctgtggtcg
gcggagttcttcaactacactgtgcggaccctgggcctgggagaggagtggcgagggggt
gatgtggcccgaacggttggtggaggacagaaggtcaggtggctaaagaaggagatggag
aaatatgcagaccgggaggatatggtcatcatgttcgtggacagctacgatgtgattctg
gctggcagccccgcagagctgctgaagaagttcgttcagagtggcagtcgcctgctcttc
tccgctgagggcttctgctggcccgagtgggggctggccgagcagtaccctgaggtgggc
acagggaagcgcttcctcaactctggtggattcattggctttgcccccaccatccacaaa
gtggtccgccagtggaagtacaaggatgacgatgacgaccagctgttctatactcggctc
tacctggacccagggctgagggaaaaactcagcctcaatctggatcataaatctcggatc
tttcagaacctcaatggggctttagatgaggtggttttaaagtttgatcggaatcgtgtg
cggatccggaatgtggcctacgacacacttcctgttgtggtccacgggaatggtcctact
aagctccatctgaattacctgggaaactatgttcctaatggctggactcctcagggaggc
tgtgggttctgtggccgggaccggaggacactcccgggggggcagcctcccccccgggtg
cttctggctgtgtttgtagaacaacctaccccattcctgccccgcttcctgcagcggctg
ctgctcctggactacccccctgacagggtcaccctgttcctgcataacaacgaggtgtac
catgagccccacatcgcagactcctggccccagctccaggaccacttctcagctgtgaag
ctggtgggaccagaggaggccctgacaccaggcgaggccagggacatggccatggacagt
tgtcggcaggacccagagtgtgaattctacttcagcctggacgctgatgccgtcatcacc
aaccctcagacactgcgcatcctcattgaagagaacaggaaggtgatagcacccatgctg
tcccgccacgggaagctgtggtccaacttctggggagccctgagccccgatgagtactac
gctcgctcggaggactatgtggagctggtacagcggaagcgagtgggcgtgtggaatgtg
ccctatatatcccaggcatacgtgatccgtggtgagaccctgaggacagagctgccccag
agggaggtgttctcaggcagtgacaccgacccagacatggccttctgtaagagcctgcgg
gataagggcatcttcctccaccttagtaatcagcacgagtttggccgcctcctggccact
tcccggtatgacacagaccatctgcacccggacctctggcagatcttcgacaaccccctg
gattggaaggagcagtacattcatgagaactacagccgggcccttgaaggggaggggctc
gtggaacagccgtgcccagatgtgtactggttccccctgctgtccgaccagatgtgtgac
gaactggtggaggaaatggagcactatggccagtggtcaggaggccggcatgaggactca
aggctggctggaggctacgagaatgtgcccactgtggacatccatatgaagcaggtgggc
tatgaagaccagtggctgcagctattgaggacgtacgtgggccccatgacagagagcctg
ttcccaggctaccacaccaagacccgggcagtgatgaactttgtggtccgttaccggcca
gatgagcagccctctttgcggccccatcacgactcatccaccttcactctcaacgtggcc
ctcaaccacaagggcctggattatgagggaggtggctgtcgcttcttgcgctatgactgc
atagtctcatccccacggaagggctgggggctcctgcaccccggccgtctcacccactac
cacgaggggctgcccactactcggggcactcgctacatcatggtgtcctttgtcgatccc
tga

DBGET integrated database retrieval system