KEGG   Canis familiaris (dog): 479854Help
Entry
479854            CDS       T01007                                 

Gene name
USP7
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 7 isoform X1
  KO
K11838  ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04068  FoxO signaling pathway
cfa05168  Herpes simplex infection
cfa05169  Epstein-Barr virus infection
cfa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    479854 (USP7)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    479854 (USP7)
  Infectious diseases
   05168 Herpes simplex infection
    479854 (USP7)
   05169 Epstein-Barr virus infection
    479854 (USP7)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     479854 (USP7)
Peptidases [BR:cfa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   479854 (USP7)
Ubiquitin system [BR:cfa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    479854 (USP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: USP7_ICP0_bdg USP7_C2 UCH UCH_1 MATH
Motif
Other DBs
NCBI-GeneID: 479854
NCBI-ProteinID: XP_005621615
Ensembl: ENSCAFG00000018993
UniProt: F1PX83
Position
6
AA seq 1086 aa AA seqDB search
MAGNHKLGQEAGDTDDPPRITQNPVINGNVAMSDGHNNTEEDMEDDTSWRSEATFQFTVE
RFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFLQCNAESDSTSWSCHAQA
VLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQ
ADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSV
PLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCV
EGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGD
NKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEF
LQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEH
NYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQAVTDHDIPQQLVERLQEEKRIEAQKRK
ERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNSSLAEFVQNLSQTMGFP
QDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLETVDPELAASGATL
PKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCDRAGFIQDTSLILYE
EVKPNLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDV
IFCDKTIPNDPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQFFKSQGYRDGPGNPLRHN
YEGTLRDLLQFFKPRQPKKLYYQQLKMKITDFENRRSFKCIWLNSQFREEEITLYPDKHG
CVRDLLEECKKAVELGEKASGKLRLLEIVSYKIIGVHQEDELLECLSPATSRTFRIEEIP
LDQVDIDKENEMLVTVAHFHKEVFGTFGIPFLLRIHQGEHFREVMKRIQSLLDIQEKEFE
KFKFAIVMMGRHQYINEDEYEVNLKDFEPQPGNMSHPRPWLGLDHFNKAPKRSRYTYLEK
AIKIHN
NT seq 3261 nt NT seq  +upstreamnt  +downstreamnt
atggcggggaatcacaagcttggacaagaagctggagacacagatgacccaccaagaatt
actcaaaaccctgttatcaacgggaatgtagccatgagtgatgggcacaacaacacagag
gaagatatggaggatgacacgagttggcgctccgaggccacgtttcagttcactgtggag
cgcttcagcagactgagtgagtcggtccttagccctccgtgttttgtgcgaaatctgcca
tggaagattatggtgatgccacgcttttatccagacagaccacaccaaaaaagcgtagga
ttctttctccagtgcaatgctgaatctgattccacgtcgtggtcttgccatgcgcaagct
gtgctgaagataataaattacagagacgatgagaagtcgttcagccgacgcattagccac
ttgttcttccacaaggagaatgattgggggttttccaatttcatggcctggagcgaagtg
actgatcctgagaaaggatttatagatgatgacaaagttacttttgaagtctttgtacag
gcggatgctccccatggagttgcgtgggattcaaagaagcacacgggctatgtcggttta
aagaatcagggagcgacttgttacatgaacagcctgctgcagactttatttttcacaaat
caactacgaaaggctgtgtacatgatgccaacagagggtgatgattcatccaaaagcgtc
cccttagcattacaaagagtgttctacgaattacagcacagcgataagcctgtaggaaca
aaaaagctaacgaagtccttcgggtgggaaactttagatagcttcatgcagcacgacgtt
caagagctgtgtcgagtgttgcttgataatgtggagaataagatgaaaggcacgtgtgtg
gagggcaccatacctaaattattcagaggcaaaatggtgtcctatatccagtgcaaagaa
gtagactatcgatctgatagaagagaagattattacgatatccagctaagtataaaagga
aagaaaaatatatttgaatcattcgtggattacgtggccgtagagcaactagatggtgac
aataaatacgacgccggggaacacggcttgcaggaagcagagaaaggtgtgaaattccta
actttgccaccagtgttacatctacagctgatgagatttatgtatgaccctcagacggac
caaaatatcaagatcaatgataggtttgaattcccagaacagttaccactcgatgaattt
ttgcaaaaaacagatcctaaggaccctgcaaattatattcttcatgcagtcctggttcac
agtggagataatcatggtggacattatgtggtttatctaaaccccaaaggggatggcaaa
tggtgtaaatttgacgacgacgtggtgtccaggtgtacgaaggaggaggccatcgagcac
aactacggggggcacgatgacgacctgtctgtgcggcactgcacgaacgcatacatgctg
gtgtacatcagggaatcaaagctgagtgaggttttacaagctgtcaccgaccacgacatc
ccccagcagttggtagagcgactccaagaagagaagaggatcgaggcccaaaagcggaag
gagcggcaggaagcccacctctacatgcaggttcagatagtcgcagaggaccagttttgt
ggccaccagggaaatgatatgtacgatgaagaaaaagtgaaatacactgtgttcaaagta
ttgaaaaattcttccctggctgaatttgtgcagaacctctcgcagaccatgggatttccc
caagatcaaattcgattatggcccatgcaggcaaggagcaacggaaccaaacggccggcg
atgttggataacgaggcagacggcaacaagacgatgattgagctgagtgataatgaaaac
ccgtggacgatattcctggaaaccgttgatccagagctggctgccagtggagccacgtta
cccaaatttgacaaagatcatgatgtcatgctatttttgaagatgtatgaccccaaaaca
cggagcttaaattactgtgggcacatctacacaccaatatcctgtaaaatacgtgacctg
cttccggttatgtgtgacagagcaggatttatccaggatactagccttatcctctatgag
gaagttaaaccgaatttaacagagagaattcaggactacgacgtgtctctcgataaagcc
cttgatgaactaatggacggtgacattatcgtcttccagaaggatgaccctgagaatgat
aacagtgaattacccactgcaaaagaatatttccgagacctctaccaccgtgttgatgtc
attttctgtgataaaacaatccctaatgatcctggatttgtggttacattatcaaaccga
atgaattattttcaggtcgcaaagacagtagcacagagactcaacactgaccccatgttg
ctccagtttttcaagtctcaaggctatagggacggcccaggtaaccctcttagacataat
tacgaagggactttaagagatctcctacagttcttcaagcctagacaacctaagaagctt
tactatcagcagcttaagatgaaaatcacagactttgaaaacagacgaagttttaagtgt
atttggttaaacagccagtttagggaagaggaaataacactatatcccgataagcatggg
tgtgtccgggacctgctggaagaatgtaaaaaggctgttgagctcggggagaaggcgtca
gggaagcttaggctgctagaaatcgtaagctacaagatcattggtgtgcaccaggaagat
gagctgctggaatgcttatctccggcgacgagtagaacgtttcgaatagaggaaatccct
ttggaccaggtggacatagacaaggagaatgagatgctggtcaccgtggctcacttccac
aaagaggtgttcgggacattcgggattccatttttgctcaggatacaccagggcgaacat
ttcagagaagtcatgaaacggattcagagtctgctagacatccaggaaaaggagtttgag
aagtttaaatttgccattgtgatgatgggccgacaccagtacataaatgaggatgagtat
gaagtgaacttgaaagactttgagccccaacctggtaacatgtctcatcctcggccttgg
ctagggctcgaccacttcaacaaagccccaaagaggagtcgctacacttacctggaaaag
gccattaaaatccataactga

DBGET integrated database retrieval system