KEGG   Canis familiaris (dog): 480018
Entry
480018            CDS       T01007                                 

Gene name
RCOR3
Definition
(RefSeq) REST corepressor 3 isoform X3
Organism
cfa  Canis familiaris (dog)
SSDB
Motif
Pfam: ELM2 Myb_DNA-binding Myb_DNA-bind_7
Other DBs
NCBI-GeneID: 480018
NCBI-ProteinID: XP_003435002
Ensembl: ENSCAFG00000012107
VGNC: 45448
UniProt: A0A5F4CXQ5
Position
7
AA seq 435 aa
MPGMMEKGPELLGKNRSANGSAKSPAGGGGGASSTNGGLHYSEPESGCSSDDEHDVGMRV
GAEYQARIPEFDPGATKYTDKDNGGMLVWSPYHSIPDAKLDEYIAIAKEKHGYNVEQALG
MLFWHKHNIEKSLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKSFHRIQQMLPDKTIASL
VKYYYSWKKTRSRTSLMDRQARKLANRHNQGDSDDDVEETHPMDGNDSDYDPKKEAKKEG
NTEQPVQTSKIGLGRREYQSLQHRHHSQRSKCRPPKGMYLTQEDVVAVSCSPNAANTILR
QLDMELISLKRQVQNAKQVNSALKQKMEGGIEEFKPPESNQKINARWTTEEQLLAVQGTD
PTGSSDSGSITSCPIIHSNTNSPHCHSEPASTTSSSNTACCPCSSPAASSTPAAGSVHPA
PANFKSASTTSHSPC
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgcccggcatgatggagaaagggcccgagttactggggaagaaccgatcggccaacggc
agcgccaagagcccggcgggcggcggcggcggcgcctcgtccaccaacggcgggctgcac
tactcggagcccgagagcggctgcagcagcgacgacgagcacgatgttgggatgagagtc
ggagctgaataccaagctcggatccctgaatttgatccaggtgctacaaagtacacagat
aaagacaatggaggaatgcttgtgtggtctccgtatcacagtatcccagatgccaaattg
gatgaatatattgcaattgcaaaggagaaacatggctacaatgtggagcaggcacttggc
atgttgttctggcataaacataacattgagaagtcccttgctgatctccctaatttcact
ccctttccggatgagtggacagtggaagataaagtcctgtttgaacaagcctttagtttt
catgggaagagctttcacaggattcagcaaatgcttccagataagacaattgctagcctt
gtaaaatattactattcctggaaaaaaactcgatccaggaccagcttgatggatcgccag
gctcgtaaactagccaatagacataatcagggtgacagtgatgatgatgtggaagaaaca
cacccaatggatggaaatgatagtgattatgatccaaaaaaagaagccaagaaagagggt
aatactgaacaacctgtccaaactagcaagattggacttggaaggagagaatatcagagt
ttacaacatcgccatcattctcagcgatctaagtgccgtccacctaagggcatgtactta
acccaggaagatgtggtagctgtttcctgtagtcccaatgcagccaacaccatcctgcgg
caactggacatggaactgatctctttaaaacgtcaggttcagaatgctaagcaagtaaac
agtgcacttaaacagaaaatggaaggtggaattgaagaattcaaacctcctgagtcaaat
cagaaaattaatgcccgttggaccacagaggagcagcttctagcagtgcaaggcacagac
cccacaggctcctcggactctgggtccatcacctcctgccccatcatccactccaacacc
aacagcccccattgccactctgaaccagcctccaccacttcttcgtccaacactgcctgc
tgcccctgctcttcaccggcagcctcctccactccagcagcaggctcggttcatccagcc
ccggccaactttaaatcagcctccaccacctctcattcgccctgctaa

DBGET integrated database retrieval system