KEGG   Canis familiaris (dog): 480088Help
Entry
480088            CDS       T01007                                 

Gene name
MPZL1
Definition
(RefSeq) myelin protein zero-like protein 1
  KO
K06770  myelin protein zero
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    480088 (MPZL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:cfa04515]
    480088 (MPZL1)
Cell adhesion molecules [BR:cfa04515]
 Immunoglobulin superfamily
  P0
   480088 (MPZL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set ig Ig_3 Adeno_E3_CR2 Rax2 Syndecan I-set EphA2_TM
Motif
Other DBs
NCBI-GeneID: 480088
NCBI-ProteinID: XP_537211
Ensembl: ENSCAFG00000031390
VGNC: 43354
UniProt: J9NSZ7
Position
7
AA seq 336 aa AA seqDB search
MEESYVPSQAGGPASASAARRCLRARARARAAAAARPRLLPRAERGAVGPAAQRRGGGGG
GGGVGRTMAALAGAAAVLAAAARRRWPWLVLAAVLGLLTTDASGLEVYTPKEIFVANGTQ
GKLTCKFKSTNTTGTLTSVSWSFQPEGTDTTVSFFHYSQGQVYPGNYPPFKDRISWAGDL
DKKDASINIENMQFIHNGTYMCDVKNPPDIVVQPGHIRLYVVEKEILPVFPVWVVVGIVT
AVVLGLTLLISMILAVLYRRRNSKRDYTGCSTSESVSPVKQAPRKSPSDTEGLVKSLPSG
SHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggaggagtcctatgtgccatcccaggcagggggcccagcgtcagcgagcgcggcgagg
aggtgcctgcgggcgcgggcgcgggcgcgggcggctgcagcagcgaggccgaggctcctc
ccgcgagccgagcggggcgcagtggggccggcggcccagaggcgcggcggcggcggcggc
ggcggcggcgtcgggaggacgatggcagcactcgcgggagccgcggccgtgcttgcagcc
gcagcccgcaggcgctggccgtggctggtgctggcggcggtgctcgggctgttgaccact
gatgcatcaggcttggaggtgtataccccaaaagaaatcttcgtggcaaatgggacgcaa
gggaagctgacgtgcaagttcaagtctactaacactacaggcacattgacctcggtctcc
tggagcttccagccagaggggaccgacaccactgtgtcgtttttccactactcccaagga
caagtgtatcctgggaattacccaccatttaaggacagaatcagctgggctggagacctc
gacaagaaagatgcatcaatcaacatagagaatatgcagtttatacacaatggcacctat
atgtgtgatgtcaaaaaccctcctgacattgttgtgcagccaggacacattaggctctat
gttgtagagaaagagatcttgcccgtgtttccagtttgggtggtggtgggtatagttact
gctgtggtgctaggtctcactctgctcatcagcatgatcctggctgtcctctatagaagg
agaaactctaaaagggattatactggctgcagtacatcagagagtgtgtcaccggttaag
caggctccacggaagtccccctccgacacagagggtctagtaaagagcctgccttctgga
tcccatcagggcccagtcatatatgcgcagttagaccactctggtggacatcacagtgac
aagattaacaagtcagagtctgtggtgtatgcggacatccggaaaaattaa

DBGET integrated database retrieval system