KEGG   Canis lupus familiaris (dog): 480110
Entry
480110            CDS       T01007                                 

Definition
(RefSeq) histone H3.3
  KO
K11253  histone H3
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04613  Neutrophil extracellular trap formation
cfa05034  Alcoholism
cfa05202  Transcriptional misregulation in cancer
cfa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    480110
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    480110
  09163 Immune disease
   05322 Systemic lupus erythematosus
    480110
  09165 Substance dependence
   05034 Alcoholism
    480110
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfa03036]
    480110
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    480110
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    480110
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   480110
SSDB
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 480110
NCBI-ProteinID: XP_537232
Ensembl: ENSCAFG00000016119
UniProt: E2R6K5
Position
7
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgtacaaagcagactgcccgcaaatcgaccggtggtaaagcaccgaggaagcaa
ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat
cgttacaggcctggtactgtggcactccgtgaaattagacgttatcagaagtccactgaa
cttctgatccgcaaacttcctttccagcgtctggtgcgagaaattgctcaggacttcaaa
acagatctgcgcttccagagtgcagctattggtgctttgcaggaggcaagtgaggcctat
ctggtgggcctctttgaagacaccaacctgtgtgctatccatgccaaacgtgtcacaatt
atgccaaaagacatccagctagcacgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system