KEGG   Canis lupus familiaris (dog): 480266
Entry
480266            CDS       T01007                                 

Gene name
GMPR2
Definition
(RefSeq) GMP reductase 2
  KO
K00364  GMP reductase [EC:1.7.1.7]
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa00230  Purine metabolism
cfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    480266 (GMPR2)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.7  GMP reductase
     480266 (GMPR2)
SSDB
Motif
Pfam: IMPDH FMN_dh Aldolase dCache_3 Glu_synthase QRPTase_C
Other DBs
NCBI-GeneID: 480266
NCBI-ProteinID: XP_013971262
Ensembl: ENSCAFG00000012127
VGNC: 41295
UniProt: E2RBW1
Position
8
AA seq 348 aa
MPHIDSDIKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQVYTGIPIIAANMDTVGT
FEMAKVLCKFSLFTAVHKHYSLQQWKEFASQNPDCLEHLAASSGTGSSDFEQLEQILEAI
PQVKYICLDVANGYSEHFVEFVKDVRKRFPEHTIMAGNVVTGEMVEELILSGADIIKVGI
GPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVM
LGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGD
VEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQVNPIFSDES
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgcctcacatcgacagtgacatcaaactggacttcaaggatgtcttgttgaggcccaaa
cgcagtacccttaagtctcgaagtgaggtggatctcacaagatccttttcatttcggaac
tcaaagcaggtgtacactgggatccccatcattgctgccaacatggatactgtgggcacc
tttgagatggccaaggttctctgtaagttctccctcttcacagctgtccataaacactac
agcctccagcagtggaaagaatttgctagccagaatcctgactgtcttgagcatttagct
gccagctcaggcacaggctcttcggactttgagcagctggaacagatcctggaagctatt
ccccaggtgaaatatatatgcctggacgtggcaaacggctactctgaacactttgttgag
tttgtaaaggatgtgcggaagcgcttccccgaacacaccatcatggcagggaatgtagta
acaggagagatggtggaagagctgatcctatctggggctgatatcatcaaagtgggaatc
ggaccaggctctgtgtgcaccacccggaagaaaactggagtggggtacccacagctcagt
gcagtgatggagtgtgcagatgctgctcatggcctcaagggccacatcatttcagatgga
ggctgcagctgtcctggggatgtggccaaggctttcggggcaggagctgactttgtgatg
ctgggtggcatgctggctgggcacagtgaatcaggtggtgagctcattgagagagatggc
aagaagtacaagctcttttatgggatgagttctgaaatggccatgaagaagtatgctggg
ggagtggctgagtacagggcctcagagggaaagacggtggaggtgccctttaaaggggat
gtggaacataccatccgagacatccttggaggcatccgctccacatgtacctacgtggga
gcagctaaactgaaggagttgagccggagaaccaccttcatccgggtcacccagcaggtg
aatccaatcttcagtgatgagagctag

DBGET integrated database retrieval system