KEGG   Canis familiaris (dog): 480271
Entry
480271            CDS       T01007                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4 isoform X2
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00230  Purine metabolism
cfa01100  Metabolic pathways
cfa01522  Endocrine resistance
cfa04015  Rap1 signaling pathway
cfa04020  Calcium signaling pathway
cfa04022  cGMP-PKG signaling pathway
cfa04024  cAMP signaling pathway
cfa04062  Chemokine signaling pathway
cfa04072  Phospholipase D signaling pathway
cfa04114  Oocyte meiosis
cfa04211  Longevity regulating pathway
cfa04213  Longevity regulating pathway - multiple species
cfa04261  Adrenergic signaling in cardiomyocytes
cfa04270  Vascular smooth muscle contraction
cfa04371  Apelin signaling pathway
cfa04540  Gap junction
cfa04611  Platelet activation
cfa04713  Circadian entrainment
cfa04714  Thermogenesis
cfa04723  Retrograde endocannabinoid signaling
cfa04724  Glutamatergic synapse
cfa04725  Cholinergic synapse
cfa04727  GABAergic synapse
cfa04742  Taste transduction
cfa04750  Inflammatory mediator regulation of TRP channels
cfa04911  Insulin secretion
cfa04912  GnRH signaling pathway
cfa04913  Ovarian steroidogenesis
cfa04914  Progesterone-mediated oocyte maturation
cfa04915  Estrogen signaling pathway
cfa04916  Melanogenesis
cfa04918  Thyroid hormone synthesis
cfa04921  Oxytocin signaling pathway
cfa04923  Regulation of lipolysis in adipocytes
cfa04925  Aldosterone synthesis and secretion
cfa04926  Relaxin signaling pathway
cfa04927  Cortisol synthesis and secretion
cfa04928  Parathyroid hormone synthesis, secretion and action
cfa04934  Cushing syndrome
cfa04935  Growth hormone synthesis, secretion and action
cfa04970  Salivary secretion
cfa04971  Gastric acid secretion
cfa04972  Pancreatic secretion
cfa04976  Bile secretion
cfa05032  Morphine addiction
cfa05163  Human cytomegalovirus infection
cfa05166  Human T-cell leukemia virus 1 infection
cfa05200  Pathways in cancer
cfa05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    480271 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    480271 (ADCY4)
   04371 Apelin signaling pathway
    480271 (ADCY4)
   04020 Calcium signaling pathway
    480271 (ADCY4)
   04072 Phospholipase D signaling pathway
    480271 (ADCY4)
   04024 cAMP signaling pathway
    480271 (ADCY4)
   04022 cGMP-PKG signaling pathway
    480271 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    480271 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    480271 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    480271 (ADCY4)
   04062 Chemokine signaling pathway
    480271 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    480271 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    480271 (ADCY4)
   04912 GnRH signaling pathway
    480271 (ADCY4)
   04913 Ovarian steroidogenesis
    480271 (ADCY4)
   04915 Estrogen signaling pathway
    480271 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    480271 (ADCY4)
   04921 Oxytocin signaling pathway
    480271 (ADCY4)
   04926 Relaxin signaling pathway
    480271 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    480271 (ADCY4)
   04918 Thyroid hormone synthesis
    480271 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    480271 (ADCY4)
   04916 Melanogenesis
    480271 (ADCY4)
   04925 Aldosterone synthesis and secretion
    480271 (ADCY4)
   04927 Cortisol synthesis and secretion
    480271 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    480271 (ADCY4)
   04270 Vascular smooth muscle contraction
    480271 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    480271 (ADCY4)
   04971 Gastric acid secretion
    480271 (ADCY4)
   04972 Pancreatic secretion
    480271 (ADCY4)
   04976 Bile secretion
    480271 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    480271 (ADCY4)
   04727 GABAergic synapse
    480271 (ADCY4)
   04725 Cholinergic synapse
    480271 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    480271 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    480271 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    480271 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    480271 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    480271 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    480271 (ADCY4)
   04714 Thermogenesis
    480271 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    480271 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    480271 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    480271 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    480271 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    480271 (ADCY4)
   05163 Human cytomegalovirus infection
    480271 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    480271 (ADCY4)
Enzymes [BR:cfa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     480271 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 480271
NCBI-ProteinID: XP_005623330
Ensembl: ENSCAFG00000012293
VGNC: 37621
Position
8
AA seq 1133 aa
MARLFSARPPPSEDLFYETYYSLSQQYPLLLLLLGIVLCALLAVLAVASASGRDLASDPG
FLITVLCALGGFSLLLGLASCEQRLQRWTRPLSGLVWAALLGLGHGFLFTGGLVSAWDQV
SFFLFVIFTVYAMLPLGMRDATAAGLASSLSHLVVLGLYLGPQPDSQPALLPQLAANAVL
FLCGNVAGAYHKALMERALRATFREALRSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKVRGGLPPYPGPFKCSTLESPFQGKLLTPKIPVPFQSPCIPMEDIPMEVGN
PLKQPQEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATGVDIN
MRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAGAYAV
EDAAMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGPKMRPSVLMTRYLES
WGAAKPFAHLSHLESPVSTSTPLPEKTLASFSPQWSLDRSRTPRGLDDDLDTGDAKFFQV
IEQLNSQKQWKQSKDFNPLTLYFREKELEKEYRLSALPAFKYYAACTFLVFISNFVIQML
VTNRPPALAITYSITFFLFLLLLFVCFSEHLTRCVLKGPKMLHWLPTLSGLVATRPGLRI
ALGTATILLVFVMAVTSLFFLPAASNCPFRAPNVSSVAFNLSWELPGSLPLISIPYSMHC
CVLGFLSCSLFLHMSFELKLLLLLLWLGASCSLFLHSHAWLSDCLISHLYPDPLDSRPGV
LKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEQEETETMENLTRLLLEN
VLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLRLLNE
IIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDDERSCSHLGTMVEFAV
ALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVLG
KIQVTEETAQVLQSLGYTCYSRGIIKVKGKGQLCTYFLNTDLTRTGPPSATLG
NT seq 3402 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagtgcccggccgccccccagcgaagacctcttctacgagacctac
tacagcctgagccagcagtacccgctgctgctgctgctgctggggatcgtgctctgcgcg
ctcctggccgtgctggctgtcgcctccgccagcggcagggatctagcctcagacccaggc
ttcctgatcactgtgctgtgtgcgctcggcggcttctcactgctgctgggcctggcatcc
tgcgagcaacggctacagcgctggacccgtcccctgtccggcctcgtgtgggcagcgctc
ctggggctgggccatggcttcctcttcactgggggcctggtgagcgcctgggaccaggtg
tcctttttcctctttgtcatcttcaccgtgtatgccatgttgcccttgggtatgcgggat
gccaccgccgcgggccttgcctcatcactctcccacctggtggtccttgggctgtacctt
gggcctcagccggactcccagcccgcgctactgccgcagctggcagcaaacgcggtgttg
ttcctgtgtgggaatgtggccggagcgtaccacaaggcgctgatggagcgtgcgctgcgc
gccacattccgggaggcacttcgttcgctgcattcgcgccggcggctggacacggagaag
aagcaccaggaacaccttctcttgtccatccttcctgcctacttggctcgagagatgaag
gcagagatcatggcccggcttcaggctggacaggggtcacggccagagagcaccaacaac
ttccatagcctctatgtcaagagacaccaaggagttagcgtgctctatgctgacatcgtg
ggcttcacacgactggccagtgagtgctcccctaaggagttggtgctcatgctcaacgag
ctctttggcaagttcgaccagattgccaaggtcagagggggcctccctccctacccaggg
cccttcaaatgctccaccctggagagccccttccaagggaaactcctgacacctaagatc
ccagtcccatttcagagcccatgtatcccaatggaagatattccaatggaagtaggaaac
cctctcaaacaaccccaggagcatgaatgcatgcggatcaagatcctgggagactgttac
tactgtgtctctgggctaccgctctccctgccagaccacgccatcaactgtgtgcgcatg
gggctggacatgtgccgggccatcaggaaactccgggcagccaccggcgtggacatcaac
atgcgtgtgggggtgcattcaggcagtgtgctctgcggagtcatcgggctgcagaagtgg
cagtatgatgtctggtcccatgatgtcaccctggccaaccacatggaggcgggtggcgtg
ccaggaagagtacatattacaggagctaccctggccctgctggcaggggcttatgctgtg
gaggacgcagccatggaacaccgagacccataccttcgggagctaggggagcctacctac
ctagtcatcgatccccgggctgaggaagaggatgagaagggcactgcaggagggttgcta
tcctctctcgagggccccaaaatgcgtccctcagtgctgatgacccgctacctggagtcc
tggggcgcagccaagccttttgcccacctgagccacctagagagccccgtgtccacctcc
acccctctcccggagaagacgctggcctccttcagcccccagtggagcctggaccggagc
cgtaccccccggggactagatgatgacctggacactggggacgccaagttcttccaggtc
atcgaacagctcaactctcagaaacagtggaagcagtcaaaggacttcaacccactgaca
ctgtacttcagagagaaggagctggagaaagagtatcgactctctgcactccctgccttc
aaatactatgcagcctgcaccttcctggttttcatctccaattttgtcatccagatgctg
gtgaccaacaggcctccagctctggccatcacctatagcatcaccttcttcctcttcctc
ctcctcctcttcgtctgcttctcagaacacctgacgaggtgtgtcttgaaaggccccaag
atgctgcactggctgcccacactgtctggcttggtggccacccggcctggactgcgaatt
gccctgggcactgccaccatcctcctcgtttttgtcatggctgttaccagcctgttcttc
ttaccggcagcatcgaactgtcctttccgggctcccaatgtgtcctccgtggctttcaac
ctctcctgggaactccctgggtccctgcctctcatcagcatcccatactctatgcactgc
tgcgtgctggggttcctgtcctgctccctcttcctgcacatgagcttcgagctgaagttg
ctgctgcttctgctgtggctgggggcttcctgctccctcttcctgcactcccatgcctgg
ctgtccgactgcctcatctcccacctctatccggatcccttggactccaggccaggggta
ctgaaggagcccaaactgatgggagctatctccttcttcatcttcttcttcaccctcctt
gtcctggctcggcagaatgagtattactgccgcctggacttcctgtggaagaagaagctg
cggcaggagcaggaggagacagagacaatggagaacctgactcggctgctgttggagaac
gtgctccctgctcacgtggccccccagttcattggtcagaaccggcgcaacgaggacctc
taccaccagtcctacgagtgtgtctgtgtcctcttcgcctcagttccagactttaaggag
ttttactctgaatccaacatcaaccatgagggtctagagtgcctgcggctgctcaatgag
ataattgctgattttgatgagctgctctcaaagcccaagtttagtggggtggagaagatc
aaaaccattggcagcacctacatggcagctacaggcttaaatgccacctctggacaggac
gcacagcaggatgatgagcgaagctgcagccacctgggcaccatggtggagtttgcagtg
gcccttggatcaaagctggatgtcatcaataagcactcatttaacaacttccgcttacgt
gtggggttgaaccatggacctgtagtggctggagtgattggggcccagaagccacagtat
gacatctggggcaacacggtgaatgtggccagccgcatggaaagtacaggagttctgggc
aagatccaagtgactgaagagacagcgcaggtgctgcagtccttaggctatacctgctac
agccggggcatcatcaaagtcaaaggcaaagggcagctctgcacctacttcctgaacaca
gatttgacgcgaactggccctccctcggccaccctaggctga

DBGET integrated database retrieval system