KEGG   Canis familiaris (dog): 480338Help
Entry
480338            CDS       T01007                                 

Gene name
PSMA3
Definition
(RefSeq) proteasome subunit alpha type-3
  KO
K02727  20S proteasome subunit alpha 7 [EC:3.4.25.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    480338 (PSMA3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cfa01002]
    480338 (PSMA3)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:cfa03051]
    480338 (PSMA3)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     480338 (PSMA3)
Peptidases and inhibitors [BR:cfa01002]
 Threonine peptidases
  Family T1: proteasome family
   480338 (PSMA3)
Proteasome [BR:cfa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    480338 (PSMA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Proteasome Proteasome_A_N
Motif
Other DBs
NCBI-GeneID: 480338
NCBI-ProteinID: XP_537460
Ensembl: ENSCAFG00000015287
VGNC: 45090
UniProt: E2RKR4
Position
8
AA seq 255 aa AA seqDB search
MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYE
EGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYV
HAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKL
QMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGEITKGRHEIVPKDIREEAEKYA
KESLKEEDESDDDNM
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagctctatcggcaccgggtatgacctgtcagcctctacattctctcctgatgggaga
gttttccaagttgaatatgctatgaaggctgtggaaaacagtagtacagctattggaatc
agatgtaaagatggcgttgtctttggggtagaaaagttagtcctttctaaactttatgaa
gaaggttccaacaaacgactttttaatgttgatcggcatgttggaatggcagtagcgggt
ttgttggctgatgctcgttctttagcagacattgcaagagaagaagcttccaactttaga
tctaattttggctataacattccattaaaacatcttgcagacagagtggccatgtatgta
cacgcatatacactttacagtgctgttagaccttttggctgcagtttcatgttagggtct
tacagtgtgaatgacggtgcacagctctacatgattgacccatcaggagtttcatatggt
tattggggttgtgccattggcaaagccaggcaagctgcaaagacagaaattgaaaaactt
cagatgaaagaaatgacctgccgtgatattgttaaagaagttgcaaaaataatttacata
gtacatgatgaagttaaggataaagcttttgaactagagctcagctgggttggtgaaata
actaaaggaagacatgaaattgttccaaaagatataagggaagaggcagagaaatacgct
aaggaatccttaaaggaagaagatgaatcagatgatgataatatgtaa

DBGET integrated database retrieval system