KEGG   Canis familiaris (dog): 480354
Entry
480354            CDS       T01007                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cfa01009]
    480354 (AKAP5)
Protein phosphatases and associated proteins [BR:cfa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     480354 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 480354
NCBI-ProteinID: XP_005623550
Ensembl: ENSCAFG00000016026
VGNC: 37758
UniProt: E2QXA1
Position
8
AA seq 428 aa
METTVSEIQVESKDEKRPTEVSPQDERQEERASVLCFKRRKKATKAMKPKASSEAAGATM
KCPPEAEASDQPQPPGGAWASIKRLVTRRKRSESSKQQKLFEAKVQPEISAEDADLSKKK
AKSGLKIPCIKFSKGEKRSNHSKIIEDSDCSIRVQGEAEHLDTKAAAQSDDQATKTKLPQ
DVSKDVSRKGGDEICEPKVSNSTTTPGEKVISVELGLDTRHSAVHPGTLILEGDTETIEE
KQSVQPPQASALETSETEQPPVVSDVLPSPTIPDQQIVEEARSNILESEPNWEEHESREV
VAEESEPKDTELSQESELRENEVTAEKPKPEESKRMEPIAIIITDTEISEFDVKKSKNVP
KQFLISIENEQVGVFANDSGFEGRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDD
NKMNNLLQ
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggagaccacagtttctgaaattcaagttgaaagcaaggatgagaagagaccaacagaa
gttagtcctcaagatgagaggcaagaggaaagagcatcagtgctttgcttcaagagaaga
aagaaagcaaccaaagcaatgaagcccaaggctagctctgaagctgctggggcaacaatg
aagtgtccaccagaagcagaagcttccgatcagccacagcccccagggggtgcctgggcc
tcaatcaaacgtcttgtaacacgcaggaaaaggtcagaatcttcaaagcagcaaaagctc
tttgaggctaaagtacaacctgaaatcagtgctgaggatgctgatctttctaagaaaaag
gcaaaatccggacttaagattccttgcataaaattctcaaaaggagagaaaagaagtaat
cattccaaaattatagaagactcagactgcagcatcagagtccagggagaggcagaacat
ttggatacaaaagctgcagcccaatcagatgaccaggcaacaaagaccaagttgccccag
gatgtaagtaaagacgtctcacggaaaggaggtgatgagatctgtgaaccaaaggtgagc
aacagcacaactacacctggagaaaaagtgatttcagtagaacttgggttagataccagg
cattctgctgttcacccaggaactctaatccttgaaggagatactgaaacgattgaggaa
aaacagagtgttcaacccccacaagcaagcgcacttgaaacttcagaaacagaacagcca
ccagtggtttccgatgttcttccctcacctacaatcccagatcagcaaattgtggaagaa
gctagaagcaatatcctagaaagtgaaccaaattgggaagagcacgaaagtagagaagtt
gtagccgaggagagtgagcctaaagatactgaactgagccaggaatctgagctgagagaa
aatgaggtcactgcagagaaacccaaaccagaagaaagcaaaagaatggagccaattgct
attattattacagacactgaaatcagtgaatttgatgttaagaaatctaaaaatgtccct
aagcaattcttaatttctattgaaaatgagcaagtaggggtttttgctaatgatagtggt
tttgagggtagaacttcagaacagtatgaaacactcttaatagaaacagcttcttctctt
gttaagaatgccatccaattgtctatagaacagctggttaatgaaatggcctctgatgat
aataaaatgaacaatcttctacagtga

DBGET integrated database retrieval system