KEGG   Canis lupus familiaris (dog): 480404
Entry
480404            CDS       T01007                                 

Gene name
ALKBH1
Definition
(RefSeq) nucleic acid dioxygenase ALKBH1
  KO
K10765  alkylated DNA repair protein alkB homolog 1 [EC:1.14.11.51 4.2.99.18 1.14.11.-]
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    480404 (ALKBH1)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.51  DNA N6-methyladenine demethylase
     480404 (ALKBH1)
    1.14.11.-  
     480404 (ALKBH1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     480404 (ALKBH1)
SSDB
Motif
Pfam: 2OG-FeII_Oxy_2
Other DBs
NCBI-GeneID: 480404
NCBI-ProteinID: XP_537525
Ensembl: ENSCAFG00000017229
VGNC: 50620
UniProt: E2RSQ8
Position
8
AA seq 389 aa
MGKMAAAVGSVATLAAEPGEDAFRKLFRFYRQSRPGTADLGAVIDFSAAHTARGTGPGAR
KVVKSQLSVSSVSDQDAHRAGLQPVSKWQAYGLQGYPGFIFIPNPFLPGYQWHWVKQCLK
LYSQKPNVCNLDKHMSQEETQDLWEQSKELLRYKEVNKRRPRSLLEKLRWVTLGYHYNWD
SKKYSADHYTPFPSDLAFLSEQVAAACGFQGFRAEAGILNYYRLDSTLGIHVDRSELDHS
KPLLSFSFGQSAIFLLGGLKRDEAPTAMFMHSGDIMVMSGFSRLLNHAVPRVLPSPQGES
LPCCLETPLPAVLPRDSVVQPCSEEDWQVCTRYLKTARVNMTVRQVLAADQDFPSEPVEE
NQRDLTLEGFCHLDDDSSQVKRMKLDPDS
NT seq 1170 nt   +upstreamnt  +downstreamnt
atggggaagatggcggcggccgtgggctctgtagcgacgcttgcggcggagccaggggag
gacgcttttcggaagcttttccgcttctaccggcagagccgcccgggaacagcagacctg
ggagcagtcattgacttctcggcggcccacacagcccggggcacggggcctggtgcccgc
aaggtggtcaaatctcagctgagtgtgtcttctgtcagtgaccaggatgcacatagagca
ggacttcagccagtcagcaagtggcaagcctatggactccaaggctatcctggatttatt
ttcatcccaaaccccttcctcccaggttaccagtggcactgggtgaagcagtgccttaaa
ttatattcccagaaacctaatgtatgtaatctggacaagcatatgagccaagaagagacc
caggacttgtgggaacagagcaaagagctcctcaggtataaagaagtgaataaacggaga
cccagaagtttactagagaagttgcgctgggtgaccctaggctaccattataactgggat
agtaagaaatactcagccgatcattatacacctttcccttctgacctggctttcctctca
gagcaagtagctgcagcctgtggatttcagggtttccgagctgaagcaggtatcctgaat
tactaccgattggactctacactgggaatccacgtagacagatctgaactagatcactcc
aaacccctgctgtctttcagctttggacagtctgccatcttcctcctgggtggcctcaaa
agagacgaagctcccacagccatgtttatgcacagtggtgacatcatggtaatgtcaggt
ttcagtcgcctgttgaaccatgcagtcccaagagtccttccaagtcctcagggggaaagc
ctgccatgctgcctggagacgcctctgccggccgttctccccagagactccgtggtacaa
ccctgctctgaggaggactggcaagtgtgcacccgctacttgaaaactgctcgtgttaac
atgactgtccgacaggtactggccgcagaccaggacttcccttcagaacccgtggaggag
aatcaaagagacctcaccctggaaggattctgccacctggacgatgacagtagccaagta
aaacgaatgaagctcgaccctgacagctga

DBGET integrated database retrieval system