KEGG   Canis familiaris (dog): 480522Help
Entry
480522            CDS       T01007                                 

Gene name
JUP
Definition
(RefSeq) junction plakoglobin
  KO
K10056  junction plakoglobin
Organism
cfa  Canis familiaris (dog)
Pathway
cfa05200  Pathways in cancer
cfa05202  Transcriptional misregulation in cancer
cfa05221  Acute myeloid leukemia
cfa05226  Gastric cancer
cfa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    480522 (JUP)
   05202 Transcriptional misregulation in cancer
    480522 (JUP)
  09162 Cancer: specific types
   05226 Gastric cancer
    480522 (JUP)
   05221 Acute myeloid leukemia
    480522 (JUP)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    480522 (JUP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    480522 (JUP)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   480522 (JUP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm HEAT Cnd1 HEAT_2 Atx10homo_assoc Adaptin_N DUF3361 KAP Arm_2 PUL
Motif
Other DBs
NCBI-GeneID: 480522
NCBI-ProteinID: NP_001273872
Ensembl: ENSCAFG00000015912
UniProt: A0A140T8E6
Position
9
AA seq 744 aa AA seqDB search
MEVMNLIEQPIKVTEWQQTYTYDSGIHSGANTCVPSVSSKGIMEEDEACGRQYTLKKTTT
YTQVPQSQGDLEYQMSTTARAKRVREAMCPGVTGEDSSLLLATQVEGQTTNLQRLAEPSQ
LLKSAIVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALMG
SPQLVAAVVRTMQNTSDLDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVES
VLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQE
SKLIILANGGPQALVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQALGKHL
TSNSPRLVQNCLWTLRNLSDVATKQEGLESVLKILVNQLSVDDVNVLTCATGTLSNLTCN
NSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNYG
IPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQRH
VAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENIQ
RVAAGVLCELAQDKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFRISEDKNPDYR
KRVSVELTNSLFKHDPAAWEAAQSMIPINEPYADDMDATYRPMYSSDVPLDPLDMHMDMD
ADYPIDTYSDGLRPPYPTADHMLA
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgatgaacctgattgaacaacccatcaaagtgactgagtggcaacagacatac
acctatgactctggcattcactcgggtgccaacacctgtgtgccctcggtcagcagcaag
ggcatcatggaagaggatgaggcctgcgggcgtcagtacacgctcaagaagaccaccacc
tatacccaggtgccccagagccaaggtgacctggagtaccaaatgtccacgacagccaga
gccaagcgggtacgggaggccatgtgtcctggcgtgacaggcgaagacagctcgctgcta
ctggccacccaggtggaagggcagaccaccaacctgcagcggctggccgagccgtcccag
ctgctcaagtcagccatcgtacatctcatcaactaccaggacgacgccgagctggccacc
cgggccctgcctgaactcaccaaactgctcaacgacgaggacccggtggtggtgaccaag
gcagccatgatcgtgaaccagctgtccaagaaagaggcgtcacggcgggcgctgatgggc
tcgccccagctggtggcagccgtggtgcgtactatgcagaacaccagtgacctggacaca
gcccgctgcaccaccagcatcctgcacaacctctcccaccaccgcgaggggctgcttgcc
atcttcaagtcgggcggcatccctgccctggtccgcatgctcagctccccggtggagtca
gtcctgttttacgccatcaccacgctgcacaacctgctgctgtaccaggagggcgccaag
atggcggtgcgcctggcagatgggctgcagaagatggtgcccctgctcaacaaaaacaac
cccaagttcctggccatcaccaccgactgcctgcagctcctggcttatggcaaccaggag
agcaagctcatcatcttggccaatggaggaccccaggcccttgtgcagatcatgcgcaac
tacagctatgagaagctgctctggaccaccagccgtgtgctcaaggtgctgtctgtgtgt
cccagcaataagcctgccatcgtggaggctggtgggatgcaggccttgggcaaacacctg
acaagcaacagcccccgccttgtacagaactgtctctggaccttgcgcaacctctcggat
gtggccaccaaacaggagggcctggagagcgtcctgaagatcctggtgaaccagctgagt
gtggacgacgtcaatgtcctcacctgtgccacgggcactctgtccaacctgacgtgcaac
aacagcaagaataagacgctggtgacccagaacagcggcgtggaggctctcatccatgcc
atcctgcgggctggcgacaaggatgacatcacggagcccgccgtctgcgccctgcgccac
ctcaccagccgccacccggaggccgagatggcccagaactccgtgcgcctcaactacggc
atcccggccattgtcaagcttctcaaccagcccaaccagtggccgctggtcaaggcaacc
atcggcctgatcaggaatctggctctgtgcccagcaaaccatgccccactgcaggaggca
gcagttattccccgccttgtccagttgctggtcaaggctcaccaggatgcccagcgtcat
gtggctgcaggcacacagcagccctacacggacggtgtgaggatggaggagattgtggag
ggctgcactggagccctgcacatcctcgcccgggatcccatgaaccgcatggagatcttc
cgactcaacactatacccctgtttgtacagctcctgtactcgtcagtggagaacatccag
cgcgtggctgccggggtgctgtgtgagctggcccaggacaaggaggcagctgatgcaatt
gatgctgagggggcctcagctccactcatggagctactgcactcccgcaatgagggcacc
gccacctacgctgcggctgtcctgttccgcatctccgaggacaagaacccagattaccgt
aaacgcgtatctgtggagctcaccaactccctcttcaagcatgacccagctgcatgggag
gctgcccagagcatgatccccatcaatgagccctacgcagatgacatggacgccacctac
cgccccatgtactcgagtgatgtgcccctggaccccctggacatgcacatggacatggac
gcggactatcccatcgacacttacagcgacggcctgaggcccccctaccccacggcggac
catatgctggcctag

DBGET integrated database retrieval system