KEGG   Canis lupus familiaris (dog): 480673
Entry
480673            CDS       T01007                                 

Symbol
TRAF2
Name
(RefSeq) TNF receptor-associated factor 2 isoform X2
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04010  MAPK signaling pathway
cfa04064  NF-kappa B signaling pathway
cfa04071  Sphingolipid signaling pathway
cfa04141  Protein processing in endoplasmic reticulum
cfa04210  Apoptosis
cfa04217  Necroptosis
cfa04380  Osteoclast differentiation
cfa04621  NOD-like receptor signaling pathway
cfa04622  RIG-I-like receptor signaling pathway
cfa04657  IL-17 signaling pathway
cfa04668  TNF signaling pathway
cfa04920  Adipocytokine signaling pathway
cfa04932  Non-alcoholic fatty liver disease
cfa05010  Alzheimer disease
cfa05014  Amyotrophic lateral sclerosis
cfa05016  Huntington disease
cfa05017  Spinocerebellar ataxia
cfa05022  Pathways of neurodegeneration - multiple diseases
cfa05132  Salmonella infection
cfa05135  Yersinia infection
cfa05160  Hepatitis C
cfa05163  Human cytomegalovirus infection
cfa05167  Kaposi sarcoma-associated herpesvirus infection
cfa05168  Herpes simplex virus 1 infection
cfa05169  Epstein-Barr virus infection
cfa05170  Human immunodeficiency virus 1 infection
cfa05200  Pathways in cancer
cfa05203  Viral carcinogenesis
cfa05222  Small cell lung cancer
cfa05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    480673 (TRAF2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    480673 (TRAF2)
   04064 NF-kappa B signaling pathway
    480673 (TRAF2)
   04668 TNF signaling pathway
    480673 (TRAF2)
   04071 Sphingolipid signaling pathway
    480673 (TRAF2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    480673 (TRAF2)
   04217 Necroptosis
    480673 (TRAF2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    480673 (TRAF2)
   04622 RIG-I-like receptor signaling pathway
    480673 (TRAF2)
   04657 IL-17 signaling pathway
    480673 (TRAF2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    480673 (TRAF2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    480673 (TRAF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    480673 (TRAF2)
   05203 Viral carcinogenesis
    480673 (TRAF2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    480673 (TRAF2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    480673 (TRAF2)
   05160 Hepatitis C
    480673 (TRAF2)
   05168 Herpes simplex virus 1 infection
    480673 (TRAF2)
   05163 Human cytomegalovirus infection
    480673 (TRAF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    480673 (TRAF2)
   05169 Epstein-Barr virus infection
    480673 (TRAF2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    480673 (TRAF2)
   05135 Yersinia infection
    480673 (TRAF2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    480673 (TRAF2)
   05014 Amyotrophic lateral sclerosis
    480673 (TRAF2)
   05016 Huntington disease
    480673 (TRAF2)
   05017 Spinocerebellar ataxia
    480673 (TRAF2)
   05022 Pathways of neurodegeneration - multiple diseases
    480673 (TRAF2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    480673 (TRAF2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    480673 (TRAF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cfa03019]
    480673 (TRAF2)
   04121 Ubiquitin system [BR:cfa04121]
    480673 (TRAF2)
Enzymes [BR:cfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     480673 (TRAF2)
Messenger RNA biogenesis [BR:cfa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     480673 (TRAF2)
Ubiquitin system [BR:cfa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    480673 (TRAF2)
SSDB
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-RING_6 zf-C3HC4_4 MATH zf-RING_2 SlyX DUF1664
Other DBs
NCBI-GeneID: 480673
NCBI-ProteinID: XP_005625129
Ensembl: ENSCAFG00000019541
VGNC: 47763
UniProt: F6XG92
Position
9
AA seq 523 aa
MAAASVTPPGSLDLLQPGFSKTLLGTKPEDKYLCSACRNVLRRPFQAQCGHRYCSYCLSS
ILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPNNGCTWKGTLKE
YESCHEGHCPFMLTECPACKGLVRLGEKEHHSEHECPERSLSCRHCRAPCCWADLKAHHE
VCPKFPLTCDGCGKKKISREKFQDHVRACGKCRVPCRFHVVGCPEMVESEKQQQHEAHWL
REHLAMLLGSLLEAKHLSGAGGPFLGLSEMGGWEASTLHPEAELSKAAELQQRCEALERK
TATFENIVCVLNREVERVAMTAEACGRQHQLDQDRIEALSNKVQQLERTIGLKDLAMAEL
EQKVHEMEASTFDGVFIWKISDFARKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRIYLNG
DGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQR
PVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggctgcagccagcgtgacccctcccggctccctagacttgttgcagcctggcttctcg
aagaccctcctggggaccaagccagaggacaagtacctgtgctcagcctgtaggaatgtc
ttgcgcagacccttccaggcccagtgtggccaccgctactgctcttactgcctgagcagc
atcttgagctctgggcctcagaactgtgccgcctgtgttcacgagggcatatatgaagaa
ggcatttctattttggaaagcagttcggctttcccagacaacgctgcacgcagggaggtg
gagagcctgccggccgtctgtcccaacaatggctgcacctggaaggggacccttaaagag
tatgagagctgccacgaaggacactgcccgttcatgctgactgagtgcccagcttgcaaa
ggcctggttcgcctgggggagaaagagcaccactcggagcacgagtgtccagagagaagc
ctcagctgcaggcactgccgggcaccctgctgctgggctgacttgaaggcacaccacgag
gtctgccccaagttccccttgacttgcgatggctgtggcaagaagaagatctcacgggag
aaattccaggaccacgtcagggcgtgtggcaagtgccgagtcccctgcaggttccatgtt
gtcggctgtcctgagatggtggagagcgagaagcagcagcagcacgaggcccattggctt
cgggagcacttggccatgttgctgggcagcctcctggaggcgaagcacctctcaggagct
ggtggccctttcctgggtctgagtgagatggggggctgggaagccagcacactgcacccc
gaggccgagctctccaaggccgcagaactccagcagcggtgtgaggccctagagaggaag
acggccaccttcgagaacatcgtatgtgtcctgaaccgggaggtggagagggtggccatg
accgctgaggcgtgtggccggcagcaccagctggaccaggacaggatcgaggccctgagt
aacaaggtgcagcagctggaaaggaccattggcctgaaggacctggcaatggccgaactg
gagcagaaggtccacgagatggaggcgtccacctttgatggcgtgttcatctggaagata
tctgattttgccaggaagcgccaggaagctgtggccggccgcacgcccgccatcttctcc
ccagccttctacacaagcaggtatggctacaagatgtgtctgcgcatctacctgaacgga
gacggcacggggcgtgggacacacctgtctctcttctttgtggtgatgaagggccccaat
gatgccctcctgcggtggcccttcaaccaaaaggtgaccttaatgctgctggaccagaac
aaccgggagcacgtgattgatgccttcaggcccgatgtgacctcatcctctttccagagg
ccagtcagtgacatgaacatcgccagcggctgcccccttttctgccccgtctccaagatg
gaggccaagaactcctatgtgcgcgatgacgccatcttcatcaaggccattgtggacctg
acggggctctag

DBGET integrated database retrieval system