KEGG   Canis familiaris (dog): 480866Help
Entry
480866            CDS       T01007                                 

Gene name
EIF2S3
Definition
(RefSeq) eukaryotic translation initiation factor 2 subunit 3
  KO
K03242  translation initiation factor 2 subunit 3
Organism
cfa  Canis familiaris (dog)
Pathway
cfa03013  RNA transport
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    480866 (EIF2S3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cfa03012]
    480866 (EIF2S3)
Translation factors [BR:cfa03012]
 Eukaryotic type
  Initiation factors
   eIF-2
    480866 (EIF2S3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF2_C GTP_EFTU GTP_EFTU_D2 RsgA_GTPase MMR_HSR1 MMR_HSR1_Xtn G-alpha Dynamin_N
Motif
Other DBs
NCBI-GeneID: 480866
NCBI-ProteinID: XP_537983
Ensembl: ENSCAFG00000013425
UniProt: E2RMK6
Position
X
AA seq 472 aa AA seqDB search
MAGGEAGVTLGQPHLSRQDLATLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKA
ISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGT
KGNFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIM
KLKHILILQNKIDLVKESQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIV
KKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQEIEVRPGI
VSKDSEGKLMCKPIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQVLGA
VGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAV
KADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggcggggggcgaggctggagtgactctggggcagccgcacctttctcgccaggatctc
gccaccttggatgttaccaagttgactccactttcacacgaagttatcagcagacaagcc
acaattaatataggtacaattggtcatgtggctcatgggaaatccacagttgtaaaagct
atttctggagttcacactgtcaggttcaaaaatgaactagaaagaaatattacaatcaag
cttggatatgctaatgctaagatttataaacttgacgacccaagttgtcctcggccagaa
tgttacagatcctgtggaagtagtacaccagatgaatttcctacagacattccagggacc
aaagggaattttaaattagtcagacatgtttcctttgttgactgtcctggccatgatatt
ttgatggctactatgctaaacggtgcagcagtgatggatgcagctcttctgttgatagct
ggtaatgagtcttgtcctcaacctcagacttctgaacacttggctgctatagaaatcatg
aaactgaagcatattttaattttacaaaataaaattgatttggtaaaagaaagtcaggct
aaggaacagtatgaacagatccttgcatttgtacaaggcacagtagcagaaggagctcct
attattccaatttctgctcagctgaaatacaatattgaagttgtctgtgagtacatagtg
aagaaaattccagtacccccaagagactttacttcagaaccccgacttattgttattagg
tcctttgatgtcaacaaacctggctgtgaagttgatgaccttaagggtggtgtagctggt
ggtagtattctaaaaggagtattaaaggtgggccaggagatagaagtcagacctggtatt
gtctccaaagatagtgaaggaaaactcatgtgtaaaccgatcttttccaaaattgtgtca
ctttttgcagagcataatgatcttcaatatgctgctccaggaggtcttattggagtggga
acaaaaattgaccctactttgtgccgggctgacagaatggtgggacaggtacttggtgca
gttggagctttaccagagatcttcacagaattggaaatctcctatttcttactcagacgg
cttctaggtgtacgtactgaaggagacaagaaagcagcaaaggtgcaaaagctgtctaag
aatgaagtgctcatggtgaacataggatccctgtcaacaggaggaagagttagcgcagtc
aaggctgatttgggcaaaatcgttttgactaatcctgtgtgcacagaagtaggagaaaaa
attgcccttagccgaagagttgagaaacattggcgtttaattggttggggtcaaataaga
agaggagtgacaatcaagccaacagtagatgatgactga

DBGET integrated database retrieval system