KEGG   Canis familiaris (dog): 481066Help
Entry
481066            CDS       T01007                                 

Gene name
ATP11C
Definition
(RefSeq) phospholipid-transporting ATPase IG isoform X1
  KO
K01530  phospholipid-translocating ATPase [EC:7.6.2.1]
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    481066 (ATP11C)
Enzymes [BR:cfa01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.1  P-type phospholipid transporter
     481066 (ATP11C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PhoLip_ATPase_C PhoLip_ATPase_N Cation_ATPase E1-E2_ATPase Hydrolase Hydrolase_3 HAD
Motif
Other DBs
NCBI-GeneID: 481066
NCBI-ProteinID: XP_003435587
Ensembl: ENSCAFG00000019020
VGNC: 38239
UniProt: J9P0C5
Position
X
AA seq 1132 aa AA seqDB search
MQLVPSFPPASECAGEEKRVGTRTVFVGNHPVSETEAYIAQRFCDNRIVSSKYTLWNFLP
KNLFEQFRRIANFYFLIIFLVQVTVDTPTSPVTSGLPLFFVITVTAIKQGYEDWLRHRAD
NEVNKSTVYIIENAKRVRKESEKIKVGDVVEVQADETFPCDLILLSSCTSDGTCYVTTAS
LDGESNCKTHYAVRDTIALHTAESIDTLRAAIECEQPQPDLYKFVGRISIYSNSLEADAR
SLGPENLLLKGATLKNTKKIYGVAVYTGMETKMALNYQGKSQKRSAVEKSINAFLIVYLF
ILLTKAAVCTTLKYVWQSTPYNDEPWYNQKTQKERETLKVLKMFTDFLSFMVLFNFIIPV
SMYVTVEMQKFLGSFFISWDKDFYDEEIREGALVNTSDLNEELGQVDYIFTDKTGTLTEN
SMEFIECCIDGHKYKGVAQEADGLSETDGPLTYFDKADKNREELFLRALCLCHTVEIKTN
DAVDGPTESAKLTYMSSSPDEIALVKGAKKYGFTFVGIRNGHMRIENQRKEIEEYELLHT
LNFDSVRRRMSVIVKTQAGDILLFCKGADSAVFPRVQNHEIELTKAHVERNAMDGYRTLC
VAFKEIAPDDYERINRQLIEAKMALQDREEKMEKVFDDIETNMNLIGATAVEDKLQDQAA
ETIEALHAAGLKVWVLTGDKMETAKSTCYACRLFQTSTELLELTTKTIEESERKEDRLHE
LLIEYRKKLLHDFPKSTRSLKKAWTEHQEYGLIIDGSTLSLILNSSQDSSSNNYKSIFLQ
ICMKCTAVLCCRMAPLQKAQIVRMVKNLKGSPITLSIGDGANDVSMILESHVGIGIKGKE
GRQAARNSDYAVPKFKHLKKLLLAHGHLYYVRIAHLVQYFFYKNLCFILPQFLYQFFCGF
SQQPLYDAAYLTMYNICFTSLPILAYSLLEQHINIDTLTSDPRLYMKISGNAMLQLGPFL
YWTFLAAFEGTVFFFGTYFLFQTSSLEENAKVYGNWTFGTIVFTVLVFTVTLKLALDTRF
WTWINHFVIWGSLAFYVFFSFFWGGIIWPFLKQQRMYFVFAQMLSSVSTWLAIVLLIFIS
LFPEILLIVLKNVRRRSARRNLSCKRASDSLSARPSVRPLLLRTFSDESNIL
NT seq 3399 nt NT seq  +upstreamnt  +downstreamnt
atgcagctggtcccatctttccctccagcctctgagtgtgctggagaagagaaaagagtt
ggtacacgcacagtgtttgttggcaatcatccagtttcagaaacagaagcttacattgca
caaagattttgtgataatagaatagtctcatctaagtatacactttggaatttcctccca
aagaatctatttgaacagtttagaagaattgcaaatttttattttctcatcattttcctc
gtgcaggtcacagtagacacaccaactagcccagttaccagtggacttccacttttcttt
gtgataactgttacagccatcaaacagggatatgaggattggctaagacacagagctgac
aacgaagtcaacaagagtactgtttacattattgaaaatgcaaagagagtgagaaaagag
agtgaaaaaatcaaggttggtgatgtagtagaagtacaggcagacgaaaccttcccctgt
gatcttattcttctatcatcctgcactagtgatggaacctgttatgttactacagccagt
cttgatggggaatccaattgcaagacacattatgcagtacgtgataccattgcactacat
acagccgaatccattgataccctccgagcagcaattgaatgtgagcagcctcaacctgac
ctctacaagtttgttgggcgaatcagtatctatagtaatagtctggaggccgatgccagg
tctttgggacctgaaaatctcttgttgaaaggagctacactaaaaaatacaaagaagata
tatggagttgctgtttacactgggatggaaaccaaaatggctctgaactaccaagggaaa
tctcagaaacgttctgctgttgaaaaatccattaatgccttcctgatcgtgtatttattt
atcttactgaccaaagctgcagtatgcactactctaaagtatgtttggcaaagtactccc
tataatgatgaaccgtggtataatcaaaagactcaaaaagagcgggaaactttgaaggtt
ttgaaaatgttcactgacttcctgtcgtttatggttctgttcaactttattattcctgta
tccatgtatgtcacagtagaaatgcagaaattcttgggctccttcttcatttcatgggat
aaggacttttatgatgaagaaattcgtgaaggagccctggttaacacatcagaccttaat
gaagaacttggtcaggtggattatatatttacggacaagaccggaacactcacggaaaat
agcatggaattcattgagtgctgcatagatgggcacaagtataaaggagtagctcaggag
gctgatggactctctgaaactgatggacccttaacatattttgacaaagcagataagaac
cgagaagagctctttctgcgtgccttgtgtttatgtcatactgtagaaattaaaacaaat
gatgctgttgatggacctacagaatcagccaaattaacttacatgtcctcttcaccagat
gaaattgctttggtgaaaggagctaaaaagtatgggttcacatttgtaggaattcggaat
ggccacatgagaatagagaaccaaagaaaggaaatagaagagtatgaacttcttcacacc
ttaaacttcgattctgtccgtcgtcgtatgagtgtaattgtgaagactcaagcaggagac
atacttctcttttgtaaaggagcagattcagcggttttccctagggtgcaaaatcatgaa
attgagttaactaaagcccatgtggaacgtaatgcaatggatgggtaccggacactttgc
gtagccttcaaagaaattgctccagatgattatgaaagaattaacagacagctcatagag
gcaaaaatggccttacaagacagagaagaaaaaatggaaaaggtttttgatgatattgag
acaaacatgaatttgattggagccactgcagtggaagacaagctacaggatcaagcagct
gagaccattgaagctctgcatgcagcaggtctgaaagtctgggtgcttactggggacaag
atggagacggccaaatccacctgctatgcgtgccgccttttccaaaccagcactgagctc
ttggaactgactacaaaaacgatcgaagaaagtgaaaggaaagaagatcgattacatgaa
ttgttgatagaatatcgtaagaagttgctgcatgattttcctaaaagtactagaagcctt
aaaaaagcatggacagaacatcaggaatatggattgatcatcgatggctccacattgtca
ctcatattaaattctagtcaagactccagctctaacaactacaaaagcattttcttacag
atatgcatgaagtgcactgcagtgctctgctgtcggatggcaccattacagaaagcccag
attgtcagaatggtgaagaatttaaaaggcagcccaataacactctcgataggtgatggt
gccaatgatgttagcatgatcttggaatcccatgtgggaataggtattaaaggcaaagaa
ggccgccaagcagccaggaatagcgattatgctgttccaaagtttaaacatttaaagaaa
ctgctcttggctcatggacatctatattatgtgagaatagcacaccttgtacagtatttc
ttctataagaacctttgtttcatcttgccacaatttttgtaccaattcttctgtggattc
tcacaacagccactgtatgatgccgcttacctgacaatgtacaacatctgcttcacatcc
ttgccaatcctggcctacagtctcctggaacagcatatcaatattgacactctgacctca
gatccccgattgtatatgaaaatttctggcaatgccatgttacagttgggacccttctta
tattggacgtttctagcagcgtttgaagggacagtgttcttctttgggacttactttctt
tttcagacttcatccctagaagaaaatgcaaaggtgtatggaaactggacttttggaacc
attgttttcacagtcttagtattcactgtaactctgaagctcgccttggatactcgtttc
tggacatggataaatcactttgtgatttggggttctttagccttttatgtatttttctca
ttcttctggggaggaattatttggccttttctcaaacaacagagaatgtatttcgtattt
gctcaaatgctctcttctgtatctacatggttggccatagttcttctaatatttatcagc
cttttccctgagattctcctgatagtattaaagaatgtaagaagaagaagtgccaggaga
aatctgagctgtaaaagggcatctgactcattatccgccagaccttcagtcagacctctt
cttttacgaacattctcagacgaatctaatatattgtaa

DBGET integrated database retrieval system