KEGG   Canis lupus familiaris (dog): 481098
Entry
481098            CDS       T01007                                 

Gene name
RDH5
Definition
(RefSeq) 11-cis retinol dehydrogenase isoform X1
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    481098 (RDH5)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     481098 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776
Other DBs
NCBI-GeneID: 481098
NCBI-ProteinID: XP_013972603
Ensembl: ENSCAFG00000000063
VGNC: 45454
Position
10
AA seq 372 aa
MVCQLPTRQVISQSAQIRPPAGEAVRGKELRASMNYTSLPAQPRLPPAGHSGSAMWLPLL
LGVLLWAVLWWLRDQQSLPASDAFVFITGCDSGFGRLLALRLDQRGFRVLASCLTPAGAE
DLQRVASSRLHTTLLDVTEPQSVQRAAKWVETHVGEAGLFGLVNNAGVAGIIGPTPWLTQ
DDFHRVLNVNTLGPIRVTLALLPLLQQSRGRVVNISSVLGRLAANGGGYCVSKFGLEAFS
DSLRRDVAHFGVRVSIVEPGFFRTPVTNLEHLENTLQECWARLPPSTQAHYGEAFLPKYL
QVQQHIMSLICDPDLTKVSRCLEHALTARYPRTRYSPGWDAKLLWLPASYLPASLVDAVL
TWVLPKPAQAVY
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggtttgccagttacctaccaggcaggtaatttctcagtctgctcagatcagacctcca
gctggggaggctgttaggggcaaggagttaagagccagcatgaactacacaagtcttcct
gcccagcctcggctgccacctgcaggtcactcgggctccgccatgtggctgcctctgctg
ctgggagtcttgctctgggcagtgctgtggtggctcagggaccagcagagcctgcccgcc
agcgatgctttcgtcttcatcaccggctgtgactcaggcttcgggcggcttctggcactg
agactggaccagagaggcttccgagtcctggccagctgcctgacccccgcgggggcagag
gacctacagcgggtggcctcctcccgcctccacaccaccctgcttgatgtcactgagccc
caaagtgtccagcgggcagccaagtgggtggaaacacatgtcggggaagcagggcttttt
ggtctggtgaataacgctggtgtggcagggatcatcgggcccaccccgtggctcacacag
gatgatttccatcgggtgcttaatgtgaatacgctgggtcccatcagggtcacccttgcc
ctgctgcccctcctacagcagtcccggggccgagtggtcaacatcagcagtgtcttgggc
cgcctggcagccaatggtggtggctactgtgtctccaagtttggcctggaggccttctct
gatagcctcaggcgggatgtggctcattttggggtccgagtctccatcgtggagcccggc
ttcttccgaacccccgtgacaaacctggagcatttggagaacacactgcaggagtgctgg
gcacggctacctcccagcacacaggcccactatggggaggcctttctccccaagtacttg
caagtgcagcagcacatcatgagcctgatctgtgacccagacctgaccaaggtgagcagg
tgcctggaacatgccctgactgctcgttaccccagaacccggtacagcccaggctgggat
gccaagctgctctggctgccagcctcctacctgccagccagcctggtggatgctgtgctc
acctgggtccttcccaagcctgcccaggcagtctactga

DBGET integrated database retrieval system