KEGG   Canis familiaris (dog): 481105Help
Entry
481105            CDS       T01007                                 

Gene name
ERBB3
Definition
(RefSeq) LOW QUALITY PROTEIN: receptor tyrosine-protein kinase erbB-3
  KO
K05084  receptor tyrosine-protein kinase erbB-3 [EC:2.7.10.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa01521  EGFR tyrosine kinase inhibitor resistance
cfa04010  MAPK signaling pathway
cfa04012  ErbB signaling pathway
cfa04020  Calcium signaling pathway
cfa04151  PI3K-Akt signaling pathway
cfa05205  Proteoglycans in cancer
cfa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    481105 (ERBB3)
   04012 ErbB signaling pathway
    481105 (ERBB3)
   04020 Calcium signaling pathway
    481105 (ERBB3)
   04151 PI3K-Akt signaling pathway
    481105 (ERBB3)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    481105 (ERBB3)
   05205 Proteoglycans in cancer
    481105 (ERBB3)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    481105 (ERBB3)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     481105 (ERBB3)
Protein kinases [BR:cfa01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   481105 (ERBB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain GF_recep_IV Furin-like Pkinase SKG6 Kinase-like DUF4381
Motif
Other DBs
NCBI-GeneID: 481105
NCBI-ProteinID: XP_538226
Position
10
AA seq 1339 aa AA seqDB search
MRATAPLQVLGFLLSLVRASYVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM
GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFPTLPLPNLRVVRGTQVYDGKFAIFVM
LNYNTNSSHALRQLRFTQLTEILAGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNG
RSCPPCHETCKGRCWGPRPEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQD
TDCFACRLFNDSGACVRQCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTS
CVRACPPXQMEVDKNGSKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGN
LDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGG
RSLYNRGFSLLIMKNLNITSLGLRSLKEISAGRIYISANKQLCYHHSLNWTRLLRGPPEE
RLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEP
REFAHEAECFSCHPECQPMEGTATCNGSGSDACAQCAHFRDGPHCVSSCPNGVLGAKGPI
YKYPDTHNECRPCHENCTQGCKGPELQDCLGQTLALISKTHLAVGLTVVVGLAVIFLILG
GTLLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVLARIFKETELRKLKVLGSGVF
GTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQDVTDHMLAIGSLDHAHIVRLLGLCPG
SSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNV
LLKSPSQVQVADFGVADLLPPDDKQLLHSEAKTPIKWMALESIHFGKYTHQSDVWSYGVT
VWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKE
LANEFTRMARDPPRYLVIKRESGPGIPPGAEPPALTNKELEEVELEPELELDLDLETEED
GLAATLNSALGLPVGTLNRPRGSQSLLSPSSGYMPMNQGNLGDTCQESAICGTGERCPRP
ASLHPMPRGRLASESSEGHVTGSEAELQEKASMCRSRSRSPRPRGDSAYHSQRHSLLTPV
TPLSPPGLEEEDVNGYVMPDAHLKGTPSSREGTLSSVGISSVLGTEEEEEDEEYEYMNRR
RRHSPPRHPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLNPVPLMPAAGTTPDEDYEYM
NRRHAGGAPGGDYAAMGACPAAEQGYEEMRAFQGPGNHAPHVHCARLKPLRSLEATDSAF
DNPDYWHSRLFPKADAQRT
NT seq 4020 nt NT seq  +upstreamnt  +downstreamnt
atgagggcgacagcgccgctgcaggtgctgggcttcctgctcagcttggtccgcgcctcc
tacgtgggcaactcccaggcagtgtgtcccgggactctgaacgggctgagcgtgaccggc
gacgctgagaaccaataccagaccctgtacaagctctacgagcggtgcgaggtggtgatg
gggaacctcgagatcgtgctcacagggcacaatgccgacctctccttcctgcagtggatc
cgagaagtgaccggctatgtcctggtggccatgaacgagttccccaccctgcccctgccc
aacctccgggtggtgcggggcactcaggtgtacgacgggaagttcgccatcttcgtcatg
ctcaactataacaccaactccagccatgccctgcgccagctccgcttcactcagctcacg
gagattctggcggggggagtgtatattgagaagaacgacaagctttgtcacatggacacg
atcgactggagggacatcgtgagggaccgagacgcagagatagtggtgaaggacaacggc
aggagctgtcccccgtgtcatgagacctgcaaggggcgatgctggggtcctagaccagaa
gactgccagacattgaccaagaccatctgtgcccctcagtgtaatggtcattgctttggg
cccaaccccaaccagtgctgccatgatgagtgtgcagggggctgctcaggccctcaggat
acagactgctttgcctgccgactcttcaatgacagcggggcctgtgtgcgccagtgtcca
cagcctctggtctacaacaagctaactttccagctggaacccaatccccacaccaagtat
cagtatggtggagtttgtgtagccagctgtccccataactttgtggtcgatcaaacgtct
tgtgtccgggcctgtcctccctgacagatggaagtagataaaaatggctccaagatgtgt
gaaccttgtggggggctgtgccccaaagcctgtgaggggacaggctccgggagccgcttc
cagactgtggactcgagcaacattgatggatttgtgaactgcaccaagatcctgggcaac
ctggactttctgatcactggcctcaatggagacccctggcacaagatccctgccttggac
cctgagaagctcaatgtcttccggacagtacgggagatcacaggttacctgaacatccag
tcctggcctccccacatgcacaacttcagtgtcttttccaacctgacaaccattgggggc
agaagcctatacaaccggggtttctctttgctgatcatgaagaacttgaatataacatct
ttgggcctccgatctttgaaagaaattagtgctgggcgtatttacataagtgccaacaag
caactctgctaccaccattctctgaactggaccaggctgcttcgggggcctccagaagag
aggctggacatcaagcataatcggccccgcagagactgcgtggcagagggcaaagtgtgt
gatcccctgtgctcctctgggggatgctggggcccaggtcctggtcagtgcctgtcctgt
cgaaactacagccgaggaggtgtctgtgtgacccactgcaactttctaaatggggagcct
cgtgagtttgcccatgaagctgaatgcttctcctgccacccggagtgccaacccatggag
gggactgccacatgcaatggctcgggctctgatgcctgtgctcagtgtgcccattttcga
gatgggccgcactgtgtgagcagctgccccaatggagtcctcggtgccaagggccccatc
tacaagtacccagacactcacaatgaatgtcggccctgccacgagaattgcacccagggg
tgtaagggaccagagctacaagactgtttaggtcaaacactggcactgatcagcaaaacc
catctggcagtgggcttaacagtggtagtgggattggcagtgattttcctgatcctggga
ggcactttactctattggcgtgggcgccggattcagaataagagggctatgcggcgctac
ttggaacggggtgagagcatagagcctctggatcccagtgagaaggctaacaaagtcttg
gccagaatcttcaaagaaacagagctgaggaagcttaaagtccttggctcaggcgtcttt
ggaaccgtgcacaaaggagtatggattcctgagggtgaatcaatcaagattccagtctgc
attaaagtcatcgaggacaagagtggacggcagagttttcaagatgtgacggatcatatg
ctggccattggcagcctagaccatgcccacattgtacggctgctgggactgtgcccaggg
tcatctctgcagctcgtcactcagtacttgcctctgggttccctgctggatcatgtgaga
caacaccgtggagcactggggccccagctgctgctcaattggggagtacagattgccaag
gggatgtactaccttgaggagcatggtatggtgcataggaacctggcggcccgaaatgtg
ctactgaagtcaccaagtcaggtccaggtggcagattttggggtggctgacctgctgccc
cccgatgataagcaactactacacagtgaggccaagactccaattaagtggatggccctg
gagagtatccactttggaaaatacacacatcagagtgacgtctggagttatggagtgaca
gtttgggagctgatgacctttggggcagagccctatgctgggctacgattggccgaagta
ccagatctgctagagaagggggagcgattggcacagccccagatctgtaccattgatgtc
tacatggtcatggtcaagtgctggatgattgatgagaacatccgtccaacctttaaagaa
ctagccaatgagttcaccaggatggcccgagaccccccacggtatctggtcataaagaga
gagagtgggcctggaattccccccggggcagagccccctgctctgacaaacaaggaactg
gaggaggtggagctggagccagaactggagctagatctggacttggagacggaggaggat
ggcctggcggccacactaaactctgccctcggtttgccagttggaacacttaatcggccc
cgtgggagccagagcctcttaagcccatcatctggatatatgcctatgaaccagggtaac
cttggggacacctgccaggagtctgccatttgtgggactggtgagcggtgcccccgtcca
gcctctttgcacccaatgccacggggacgcctggcatcagagtcctcagagggccatgtg
acagggtccgaggctgagctccaggagaaggcatcaatgtgtagaagccggagccggagc
ccacggccacgaggagacagtgcctaccattcccagcgccacagcctgctcactcctgtc
accccactctccccaccagggttggaggaagaggatgtcaatggatatgtcatgccagat
gcacacctcaaaggtactccctcctcccgggaaggcaccctttcttcagtgggcatcagt
tctgtcctgggtactgaagaagaggaggaagatgaggagtatgaatatatgaaccggagg
agaagacacagtccacctcgtcaccctaggcccagttctctcgaggagctgggttatgag
tacatggatgtgggatcagacctcagcgcttccctgggcagcacacagagttgcccactc
aaccctgtgcccctcatgcccgctgctggcacaaccccagatgaggactatgaatatatg
aatcggcgacatgctggaggagctcctgggggagactatgcagccatgggggcctgccca
gccgctgagcaagggtatgaagagatgagagctttccaggggcctggaaaccatgctccg
catgtccactgtgcccgcctcaaacctctacgtagtttagaagccactgactccgctttc
gataatcctgattactggcatagcaggcttttccccaaggctgatgctcagagaacataa

DBGET integrated database retrieval system