KEGG   Canis familiaris (dog): 481126Help
Entry
481126            CDS       T01007                                 

Gene name
GLI1
Definition
(RefSeq) zinc finger protein GLI1
  KO
K16797  zinc finger protein GLI1
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04024  cAMP signaling pathway
cfa04340  Hedgehog signaling pathway
cfa05200  Pathways in cancer
cfa05217  Basal cell carcinoma
Module
cfa_M00678  Hedgehog signaling
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    481126 (GLI1)
   04024 cAMP signaling pathway
    481126 (GLI1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    481126 (GLI1)
  09162 Cancers: Specific types
   05217 Basal cell carcinoma
    481126 (GLI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cfa03000]
    481126 (GLI1)
Transcription factors [BR:cfa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, GLI-like
    481126 (GLI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4
Motif
Other DBs
NCBI-GeneID: 481126
NCBI-ProteinID: XP_538247
Ensembl: ENSCAFG00000000223
VGNC: 41256
UniProt: E2QZT1
Position
10
AA seq 1105 aa AA seqDB search
MFNSMTPPPVSSYGEPCCLRPLPSQAPSMGTEGLPGLPFCHQANLMSGPHSYGPARETTS
CTEAPLFPPPRSAVKLTKKRALSISPLSDASLDLQTVIRTSPSSLVAFINSRCASPGGSY
GHLSIGTMSPSLGFPPQMNHQKGTSPSFGVQPCGPHDPSQGGMMPHPQSRGPLPTCQLKS
ELDLLVSKCPEEPLEGDMSSPNSTGTQDPLLGMLDGREDLEREGKPEPESAYETVCRWAG
CSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKPH
KCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQNRTHSNEKP
YVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGDGPLPRAPSLSTVEPKRERDGG
PTREESRLTVPEGAMKPQPSPGAQSSCSSDHSPAGSAANTDSGVEMTGNAGGSTEDLSSL
DEGPCVAGTSLSTLRRLENLRLDQLHQLRPIGPRGPKLPSLTHTGTPVSRRLGPPVSLDR
RSSSSSSVSSAYTVSRRSSLASPYPPGSPPENGASSLPGLAPAQHYLLRARYASARGGGT
PPTAAPSLDRMGSLPAPPWRSRAEYPGYNPNAGVTRRASDPARAVDRPAPARVQRFKSLG
CVHTPPTVAGGGRNFDPQLATGVYSPQPPSITENVAMDTRGLREEPEGGTSMIGSGLNPY
MDFPPADTLGYGGPEGAAAEPYGARGPGSLPLGPGPPTNYGPNPCPQQVSYPEPPSEPWG
EFPSHSGLYPGPKAPAGVYSQCPRLEHYGQVQVKPEQGCPVGSDSTGLAPCLNAHPSDGP
PHPQPLFSHYPQPPPPQYPQSGAYTQPPPDYLPSEPRPALDFDSTSHSTGQLKAQLVCNY
VQSQQELLWDGGGRGDPPVQETLYQSPKFLGGSQVSSSPAKGPVATYGPGFAPNLPNHKS
GSYPAPPPCHENFTVGANKTSHRAAAPPRLLPPLPTCYGTLKAGGTNPSCGHPEVGRLGG
GPALYAPPEGQVCNPLDSLDLDNTQLDFVAILDEAQGLSPPPSHDQGDSSEHTPPPSGPP
NMAVGNMSILLGSLPGETQFLNSSA
NT seq 3318 nt NT seq  +upstreamnt  +downstreamnt
atgttcaactcgatgaccccaccgccagtcagtagctatggagagccctgctgtctccgg
cccctccccagtcaggcccccagcatggggacagaaggactgcctggtctgcccttctgc
caccaggccaacctcatgtccggcccccacagttatgggccagccagagagaccaccagc
tgcactgaggccccactctttcctcctccccgaagtgcagtcaagttgaccaagaagcgg
gcactctccatctcacctctgtcagacgccagcctggacctgcagacagttatccgcacc
tcacccagctcccttgtggccttcatcaactcacgctgtgcatctcccgggggctcctac
ggtcacctctccatcggcaccatgagcccatctctgggattcccaccccagatgaatcac
caaaaagggacctcgccttccttcggggtccagccctgtggtccccatgacccttctcag
ggtgggatgatgccgcatcctcagtcccggggacccctcccgacttgccagctaaagtct
gagctggacctgctggttagcaagtgcccagaggagcccttggagggtgatatgtccagc
cccaactccacaggcacacaggatcccctgctggggatgctggatgggcgggaggacctg
gagagagaggggaagcctgagcctgaatctgcctatgagacggtctgccgctgggccggc
tgtagccaggaatttgactcccaggagcagctggtgcaccacatcaacagtgagcacatc
catggggagcggaaggagttcgtgtgtcactgggggggctgctccagggagctgaggcct
ttcaaggctcagtacatgctggtggtgcacatgcgcaggcatacgggcgagaagccgcac
aagtgtacgtttgaggggtgccggaagtcatactcacgcctcgaaaatctgaagacacac
ctacggtcacacacgggtgagaagccatacatgtgtgagcacgagggctgcagtaaagcc
ttcagcaatgccagtgaccgagccaagcaccagaatcggacccactccaatgagaagcca
tatgtgtgtaagctccctggctgcaccaaacgctacacggatcccagctccctccggaaa
catgtcaagacagtacatggtcccgatgcccatgtgaccaagcggcaccgaggagatggc
cccctgcccagggcaccatccctttccactgtggagcccaagagggagcgggatggaggc
cccaccagggaagagagcagactgacggtgccggagggggccatgaagccacagcccagc
cctggggcccagtcgtcctgcagcagtgaccactccccagcaggcagtgcagccaataca
gatagtggtgtggaaatgactggaaatgcagggggcagcaccgaggacctgtccagcctg
gatgaggggccttgcgtggctggcaccagtctgtccactcttcgccgccttgagaacctc
agactggaccagctgcatcaacttcggccgatagggccccggggccccaaactccccagc
ctgactcacactggcacccctgtgtcccgccgactgggcccccccgtttctcttgaccgc
cgcagcagcagctccagtagcgtcagctcagcctataccgtcagccgccgctcctccctg
gcttccccttacccccctggatccccaccagagaacggggcatcctctctgcccggcctc
gcgcctgcccagcactacctgctccgggcaagatatgcttccgccaggggaggtgggacc
ccacccacggcagcacccagcctggatcggatggggagtctcccagcacctccctggaga
agccgggctgagtatccaggatacaaccccaatgcaggggtcacccggagggccagtgac
ccggcccgggctgttgaccgccctgccccagccagagtccagcggttcaagagcttgggt
tgtgtccacacacctcccaccgtggcaggaggaggacggaacttcgatccccaactcgca
accggtgtgtactcaccacagccccccagcatcactgagaatgtcgccatggataccaga
gggctacgggaggagccagaaggtgggacctccatgataggcagtggtctgaatccctat
atggacttcccacctgctgatactttgggatatgggggacctgagggggcagcagctgaa
ccttatggagctaggggtccaggctccctacctcttgggcctggcccacccaccaactat
gggccaaacccctgtccccagcaggtctcctatcctgaaccaccctctgaaccatggggt
gagttcccttcccactccgggctatacccaggccccaaggctccagctggagtctacagc
cagtgtcctcgtcttgaacattatggacaagtgcaggtcaagccggaacaagggtgtcca
gtgggttctgattccacaggactggcaccctgcctcaatgctcaccccagtgatgggcct
cctcacccacagcctctgttctcccactacccccagcctcctcctccccagtatccccag
tcaggtgcctatacccagccaccccctgattatcttccctcagaacccaggcctgccctg
gattttgattccaccagtcactccaccggacaactcaaggctcagctggtgtgtaattat
gttcagtctcaacaggaactgctctgggatggtgggggcaggggagatcccccagtgcag
gaaactctctaccagagtcccaagtttttagggggttcccaggttagctcaagccctgcc
aagggcccagtggccacatatgggcctggctttgcacctaacctgcccaatcacaagtca
ggctcctatcctgcccctccaccgtgccatgaaaattttacagtgggggccaacaagact
tcccatagagcagcagcaccaccccgacttctgcccccactgcccacttgctatgggacc
ctcaaggcaggaggcaccaaccccagttgtggtcatcctgaggtgggcaggctgggaggg
ggtcctgccttgtacgctcctcccgaagggcaggtgtgcaaccctctggactctcttgac
cttgacaacactcagctggactttgtggctattctggatgaggcccaggggctgagtcct
cctccttcccatgatcagggggacagctctgaacacaccccacctccctctgggcccccc
aacatggctgtgggcaacatgagtatcttactgggatccctgcctggggagacacaattc
ctcaactccagcgcctaa

DBGET integrated database retrieval system