KEGG   Canis familiaris (dog): 481131Help
Entry
481131            CDS       T01007                                 

Gene name
CDK4
Definition
(RefSeq) cyclin-dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa01522  Endocrine resistance
cfa04110  Cell cycle
cfa04115  p53 signaling pathway
cfa04151  PI3K-Akt signaling pathway
cfa04218  Cellular senescence
cfa04530  Tight junction
cfa04660  T cell receptor signaling pathway
cfa04933  AGE-RAGE signaling pathway in diabetic complications
cfa04934  Cushing syndrome
cfa05160  Hepatitis C
cfa05162  Measles
cfa05163  Human cytomegalovirus infection
cfa05164  Influenza A
cfa05165  Human papillomavirus infection
cfa05166  Human T-cell leukemia virus 1 infection
cfa05167  Kaposi sarcoma-associated herpesvirus infection
cfa05169  Epstein-Barr virus infection
cfa05200  Pathways in cancer
cfa05203  Viral carcinogenesis
cfa05212  Pancreatic cancer
cfa05214  Glioma
cfa05218  Melanoma
cfa05219  Bladder cancer
cfa05220  Chronic myeloid leukemia
cfa05222  Small cell lung cancer
cfa05223  Non-small cell lung cancer
cfa05224  Breast cancer
cfa05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    481131 (CDK4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    481131 (CDK4)
   04115 p53 signaling pathway
    481131 (CDK4)
   04218 Cellular senescence
    481131 (CDK4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    481131 (CDK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    481131 (CDK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    481131 (CDK4)
   05203 Viral carcinogenesis
    481131 (CDK4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    481131 (CDK4)
   05225 Hepatocellular carcinoma
    481131 (CDK4)
   05214 Glioma
    481131 (CDK4)
   05220 Chronic myeloid leukemia
    481131 (CDK4)
   05218 Melanoma
    481131 (CDK4)
   05219 Bladder cancer
    481131 (CDK4)
   05224 Breast cancer
    481131 (CDK4)
   05222 Small cell lung cancer
    481131 (CDK4)
   05223 Non-small cell lung cancer
    481131 (CDK4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    481131 (CDK4)
   04934 Cushing syndrome
    481131 (CDK4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    481131 (CDK4)
   05162 Measles
    481131 (CDK4)
   05164 Influenza A
    481131 (CDK4)
   05160 Hepatitis C
    481131 (CDK4)
   05163 Human cytomegalovirus infection
    481131 (CDK4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    481131 (CDK4)
   05169 Epstein-Barr virus infection
    481131 (CDK4)
   05165 Human papillomavirus infection
    481131 (CDK4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    481131 (CDK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfa01001]
    481131 (CDK4)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     481131 (CDK4)
Protein kinases [BR:cfa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   481131 (CDK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 481131
NCBI-ProteinID: XP_022279812
Ensembl: ENSCAFG00000000280
VGNC: 39054
Position
10
AA seq 303 aa AA seqDB search
MATPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFSPRGPRPVQTVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLQKAEG
NPE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggctactcctcggtacgagccagtggctgagattggggttggtgcctatggaacggtg
tacaaggcccgtgatccgcacagcggccacttcgtggccctcaagagcgttagagtccct
aatggaggaggtgccggagggggccttcccatcagcacagttcgtgaagtggcattgctg
aggcggctggaggcttttgagcatcccaacgttgtccggctaatggacgtctgcgccact
gcccgaaccgaccgggagaccaaagtgaccctggtgtttgagcacgtggaccaagacctg
agaacgtacctggacaaggcacccccaccgggcttgccagtggagaccatcaaggatctg
atgcgccagtttctaagaggcctagatttccttcatgccaactgcatcgttcaccgagac
ctgaagcccgagaacattctggtgaccagtggtgggacagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggcacttacgcctgtggttgttacactctggtat
cgtgctccagaagttcttctgcagtctacgtatgcaacacccgtggacatgtggagtgtc
ggctgtatcttcgcagagatgtttcgtcgcaagcctctcttctgtggaaactctgaagct
gaccagttaggcaaaatctttgatctgatcgggctgcccccagaggatgactggccccga
gatgtgtctctgccccgaggagccttttcccctagagggccccgtccagtacagacagtg
gtacctgagatggaggagtctggagcacagctgctgctggagatgctgacttttaaccca
cacaagcgaatctctgccttccgagccctgcagcactcttatctacaaaaggcagaaggt
aacccagagtga

DBGET integrated database retrieval system