KEGG   Canis familiaris (dog): 481168Help
Entry
481168            CDS       T01007                                 

Gene name
KCNC2
Definition
(RefSeq) potassium voltage-gated channel subfamily C member 2 isoform X1
  KO
K04888  potassium voltage-gated channel Shaw-related subfamily C member 2
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cfa04040]
    481168 (KCNC2)
Ion channels [BR:cfa04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   481168 (KCNC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans BTB_2 Ion_trans_2 BTB_3
Motif
Other DBs
NCBI-GeneID: 481168
NCBI-ProteinID: XP_005625689
Ensembl: ENSCAFG00000000479
VGNC: 42237
UniProt: J9P810
Position
10
AA seq 624 aa AA seqDB search
MGKIESNERVILNVGGTRHETYRSTLRTLPGTRLALLAASEPAGDCLTAAGAPPPPPPPP
PPRPLSPGPGPCSPRGAGGGGGGGGREFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLF
EEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLLGGDPGDDDDLAAKRLGIED
AAGLGVPDGKSGRWRRLQPRVWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAF
NIVKNKTEPVINGTSVVLQYEIETDPALTYVEGVCVVWFTFEFLVRIIFSPNKLEFIKNL
LNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHT
LRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQFKNIPIGFWWAVVT
MTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRK
KHIPPAPQASSPTFCKTELNMACNSTQGDSCLGKDNRLLDHNRSVLSGDDSTGSEPPLSP
PERLPIRRSSTRDKNGRGETCFLLTTGDYTCASDGGIRKGYEKSRSLNNIAGLAGNALRL
SPVTSPYNSPCPLRRSRSPIPSIL
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagatcgagagcaacgagagggtgatcctcaatgtcgggggcacccggcacgag
acctaccgcagcaccctccggaccctgcccggcacgcgcctggccctgctcgccgcctcc
gagcccgcgggcgactgcctgacggctgccggcgctcccccgcccccgccgcccccgccc
ccgccgcggcccctgtcccctgggcctggcccctgcagcccgcggggcgccggcgggggc
gggggcggggggggacgcgagttcttcttcgaccggcacccgggcgtgttcgcctatgtg
ctcaactactaccgcaccggcaagctgcactgcccggccgacgtgtgcgggccgctcttc
gaggaggagctggccttctggggcatcgacgagacggacgtggagccctgctgctggatg
acctaccggcagcaccgcgacgccgaggaggcgctcgacatcttcgagacgcccgacctc
ctgggtggcgaccccggcgacgacgacgacctggcggccaagaggctgggcattgaggac
gccgcgggcctgggggtccccgacggcaagtccggccgctggcggaggctgcagccccgc
gtgtgggcgctcttcgaggacccctactcgtccagagccgccaggtttattgcttttgct
tctttattcttcatcctggtttcaatcacaaccttttgcctggagacacacgaagctttc
aatattgttaaaaacaagacagaaccagtcatcaatggcacgagtgttgttctgcaatac
gaaatcgaaacggatcctgccttgacgtatgtagaaggagtgtgtgtggtgtggtttact
tttgaatttttagtccgtatcattttttcccctaataaacttgaattcatcaaaaatctc
ttgaatatcattgactttgtggccatcctacccttctacttagaggtgggactcagtggg
ctgtcatccaaagctgctaaggatgtacttggcttcctcagggtggtaaggttcgtgagg
atcctgagaatcttcaagctcacccgccattttgtaggtctgagggtgcttggacacact
cttcgagccagtactaatgagtttttgctgctgataatcttcctggctctaggagttttg
atatttgctaccatgatctactatgccgagagagtaggagctcaacctaacgacccttca
gctagtgagcacacgcagtttaaaaacattccaattggcttctggtgggctgtggtgacc
atgaccaccttgggctacggggatatgtacccccaaacgtggtcggggatgctggtggga
gccctgtgtgccctggctggggtgctgacgatagccatgcccgtgccggtcatcgtcaac
aactttggaatgtactactccttggctatggcgaagcagaaacttccaaggaagagaaag
aagcacatccctcccgccccccaggcaagctcgcctaccttttgcaagacagaattaaac
atggcctgcaacagcacacagggcgactcctgtctgggcaaggacaaccggcttctggac
cataacagatcagtgttatcaggtgacgacagtacaggaagtgagccgccattatcaccc
ccagaaaggctccccatcagacgctctagtaccagagacaaaaacggaagaggggaaaca
tgttttctactgacgacaggtgattacacgtgtgcttctgacggagggatcaggaaagga
tatgaaaagtcccgaagcttaaacaacatagcaggcttggcaggcaatgctctgaggctg
tctccagtcacatcaccctacaactctccttgtcctctgaggcgctcccgatctcccatc
ccatctattttgtaa

DBGET integrated database retrieval system