KEGG   Canis familiaris (dog): 481243Help
Entry
481243            CDS       T01007                                 

Gene name
CACNA1I
Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1I
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04010  MAPK signaling pathway
cfa04020  Calcium signaling pathway
cfa04713  Circadian entrainment
cfa04925  Aldosterone synthesis and secretion
cfa04927  Cortisol synthesis and secretion
cfa04929  GnRH secretion
cfa04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    481243 (CACNA1I)
   04020 Calcium signaling pathway
    481243 (CACNA1I)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    481243 (CACNA1I)
   04925 Aldosterone synthesis and secretion
    481243 (CACNA1I)
   04927 Cortisol synthesis and secretion
    481243 (CACNA1I)
  09159 Environmental adaptation
   04713 Circadian entrainment
    481243 (CACNA1I)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    481243 (CACNA1I)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cfa04040]
    481243 (CACNA1I)
Ion channels [BR:cfa04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   481243 (CACNA1I)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 481243
NCBI-ProteinID: XP_022280009
Ensembl: ENSCAFG00000001314
VGNC: 38639
Position
10
AA seq 2163 aa AA seqDB search
MAESSPPPSSSSATAPAAEPGVTEQPGPQSPPPSPPGPEEPLDGADPEVPHPDLAPVAFF
CLRQTTSPRNWCIKMVCNPWFECVSMLVILLNCVTLGMYQPCDDMDCLSDRCKILQVFDD
FIFVFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTV
RVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCF
LEENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDDV
YDFGAGRQDLNASGLCVNWNRYYNVCRTGSANPHKGAINFDNIGYAWIVIFQVITLEGWV
EIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHRLMLEQRQRYL
SSSTVASYAEPGDCYEEIFQYICHILRKARRRALGLYQALQSRRQASAPGAPTSTKPGPH
AKEPRHYKLCPQHSPLDPTPHTLVQPISAMLASDPASCPRCQHEESRRPSGPGSTDSGQE
GSGSGGSGGGSEEADGDGARSSEDGASSGLGKEDEEEKADGATRLCGDVWRETRAKLRGI
VDSKYFNRGIMMAILVNTVSMGIEHHEQPEELTNILEICNVVFTSMFALEMLLKLAAFGL
FDYLRNPYNIFDSIIVIISIWEIVGQADGGLSVLRTFRLLRVLKLVRFMPALRRQLVVLM
KTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLRTDTGDTVPDRKNFDSLLWAIVTVFQ
ILTQEDWNVVLYNGMASTSPWASLYFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSYS
DEDQSSSNMEDFDKLQEGLDGSGDPKLCPIPMTPNGHLDPNLPLGGHLGPAGAAAPAPRL
SLQPDPVLVALGSRKSSVMSLGRMSYDQRSLSSSRSSYYGPWGRSGAWASRRSSWNSLKH
KPLSAEHESLLSAERGGGPRACEGARDEGPPRAAPPHAPHAHHVHHGPHAAHRHRHHRRT
LSLDTRDSMDLAELVPAVGAHPRAAWRAVGPAPGHEDCNGRMPSIAKDVFTKMDDRRDRG
EDEEEIDYTLCFRVRKMIDVYKPDWCEVREDWSVYLFSPENRFRVLCQTIIAHKLFDYVV
LAFIFLNCITIALERPQIEAGSTERIFLTVSNYIFTAIFVGEMTLKVVSLGLYFGEQAYL
RSSWNVLDGFLVFVSIIDIVVSVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVV
ETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNRSDCVAANYRW
VHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVPNHNPWMLLYFISFLL
IVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRKAQRLPYYATYCPT
RLLIHSMCTSHYLDIFITFIICLNVVTMSLEHYNQPTSLETALKYCNYMFTTVFVLEAVL
KLVAFGLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMRVLRIARVL
KLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNDENPCEGMS
RHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRDCTHDERSCLSSLQFVSPLYFVSFVLT
AQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAELELEMAHGLGPSPRPPSSSPGAPGRGP
GGAGGGGGGDPEGRLCRRCYSPAQENLWLDSVSLIIKDSLEGELTIIDNLSGSIFHHYSS
PAGCEKCHHDKQEVQLAETEAFSLNSDKSSSILLGDDLSLEDPTACPVGPKDSRGEPDTP
EPMQVEEVGECFFPLSNTAVSSDPENFLWEKEAVPSNPVRSWLKQESSRAAPPSPFSPDA
SSPLLPMPAEFFHPAVSASQKGQDKGAGAGTLPKIALQGSWASLRSPSVNCTLLRQATGS
DTSLEASRSSSAGSLQTTLEDSLTLSDSPRRALGPPAAAAPPGPRAGPSPAARRPSLRGR
GPFSLRGLRAHQRSHSSGGSTSPGCTRRDSLDASDEEGAGGRGGAGGEPSEALSSLSLTA
LFAPPPPGLPGARRSSSTSSRAAKAAAAPAPAPAPTASPEPQPGPGPGPEQRQAGAAAGK
RKR
NT seq 6492 nt NT seq  +upstreamnt  +downstreamnt
atggctgagagctccccgccgccctcctcctcgtctgccaccgccccagcagctgagcct
ggagtaacggagcagccggggccccagagcccccctccctcccctccaggcccggaggag
cccctggatggagccgatcctgaagtccctcacccggacctggcgccggttgccttcttc
tgtctgcgacagaccaccagcccccggaactggtgcatcaagatggtgtgtaacccatgg
tttgaatgtgtcagcatgctggtgatcctgctgaactgcgtgacacttggcatgtaccag
ccctgcgacgacatggactgcctctccgaccgctgcaagatcctgcaggtctttgatgac
ttcatcttcgtcttctttgccatggagatggtgctcaagatggtggccctgggcattttt
ggcaagaagtgctaccttggggacacatggaaccgactggatttcttcatcgtcatggca
gggatggtcgagtactccctggaccttcagaacatcaacctgtcggccatccgcaccgtg
cgtgtcctgaggcccctcaaagccatcaaccgtgtgcccagtatgcggatcctggtgaac
ctcctcctggacacactgcccatgctggggaacgtcctcctcctctgcttctttgtcttc
ttcatcttcggcatcatcggcgtccagctctgggcaggcctgctgcgtaaccgctgcttc
ctggaggagaacttcaccatacaaggggatgtagccctgcccccctactaccagccagag
gaggacgatgagatgcctttcatctgctccctttcgggggacaatggcatcatgggctgc
cacgagatccccccactcaaggagcagggccgcgagtgctgcctgtccaaggatgatgtc
tacgacttcggggcagggcgccaggacctcaatgccagcgggctgtgtgtcaactggaac
cgctactacaacgtgtgccgcacaggcagtgccaacccccacaagggtgccatcaacttt
gacaatatcggttacgcctggatcgtcatcttccaggtgattactctggaaggctgggtg
gagatcatgtactatgtgatggatgctcactccttctacaacttcatctattttatcctg
cttatcatagtgggctccttcttcatgatcaacctgtgcctcgttgtcatagcgacccag
ttctcggagaccaagcagcgggagcaccggctgatgctggagcagcggcagcgctacctg
tcctccagcacggtggccagctacgcggagcccggcgactgttacgaggagatcttccag
tacatctgccacatcctgcgcaaggccaggcgccgcgccctgggtctctaccaggccctg
cagagccgccgacaggcctcggccccgggggcacccacctccaccaaacccgggccccac
gccaaggagcccaggcactacaagctgtgccctcaacacagtcccctggacccgacgccc
cacacgctggtgcagcccatctctgccatgctggcctccgaccctgccagctgcccccgc
tgccagcatgaggagagtcggcggccctcgggcccgggcagcactgactcgggccaggag
ggctcgggctctggtggctcaggtggcggctcggaggaggccgatggggacggggcccgg
agcagcgaggacggggcctcctctgggctggggaaggaggacgaggaggagaaggcggac
ggggccacccggctgtgtggggatgtgtggcgggagactcgagccaagcttcgaggcatc
gtggacagcaaatacttcaaccggggcatcatgatggccatcctggtcaacaccgtcagc
atgggcatcgagcaccacgagcagcccgaggagctgaccaacatcctggagatctgcaac
gtggtcttcaccagcatgttcgccctagagatgctcctgaagctggctgccttcggactc
tttgactatctgcgcaacccttacaacatttttgacagcatcatcgttatcatcagcatc
tgggagatcgtggggcaggcggacggcggcctgtcggtgctgcggaccttccggctgctg
cgggtgctgaagctggtgcgcttcatgcccgcgctgcggcgccagctggtggtgctcatg
aagaccatggacaacgtggccaccttctgcatgctgctcatgctcttcattttcatcttc
agcatccttgggatgcacatctttggctgcaaattcagcctccgtacggacacaggagac
actgtccccgacaggaagaactttgactccctgctgtgggccatcgtcacagtgttccag
attctcacccaggaggactggaacgttgtcctctacaatggcatggcctccacctccccc
tgggcctccctctattttgtcgccctcatgaccttcggcaactacgtgctcttcaacctc
ttggtggccatcctggtggaaggcttccaggcagagggtgacgccaatcgctcctactcg
gacgaggaccagagctcatccaacatggaagattttgacaagcttcaggagggcctggat
ggcagtggagatcccaagctctgcccaatccccatgacccccaatgggcacctggacccc
aatctcccgctgggtggacatctgggccctgccggagctgcagcacctgccccccgcctc
tcgctgcagccggaccccgtcctggtggccctgggctcccgcaagagcagtgtcatgtca
ctgggcaggatgagctatgaccagcgctccctgtccagctcccggagctcctactacgga
ccgtggggccgcagcggggcctgggccagccgccgctccagctggaacagcctcaagcac
aagccgctgtcggccgagcacgagtccctgctgtcggcggagcgcggtggcggcccccgg
gcctgcgagggcgccagggacgaggggccgccgcgggccgcgccgccgcatgctccgcac
gcccaccacgtgcaccacggcccccacgcggcgcaccggcaccgccaccaccgccggacg
ctgtccctcgacaccagagactccatggacctggccgagctggtgcccgccgtgggcgcc
cacccccgggcggcctggagggcggtgggcccggcccccgggcacgaggactgcaatggc
aggatgcccagcatcgccaaggacgtctttaccaagatggatgaccgtcgggatcgcggg
gaggacgaggaggagatcgactacaccctgtgcttccgcgtccgcaagatgatcgacgtc
tacaagcctgactggtgcgaggtccgcgaggactggtctgtctacctcttctcccccgag
aacaggttccgagtcctgtgtcagaccatcatcgcccacaagctcttcgactatgtggtc
ctggccttcatctttctcaactgcatcaccatcgccctggagaggccccagatcgaggct
ggcagcactgaacgcatcttcctcactgtgtcgaactacatcttcacagccatctttgta
ggcgagatgacgctgaaggtggtctcgctgggcctgtacttcggggagcaggcctacctg
cgcagtagctggaatgtgctggacggcttcctcgtcttcgtgtccatcatcgacatcgtg
gtttccgtggcctcagcggggggagccaagatcctaggggtccttcgggtcctgcggctc
ctgcgcaccctacgccccctgcgtgtcatcagccgagctcctggtctgaagctggtggtg
gagacacttatctcttccctcaagcccattggcaacatcgtcctcatctgctgtgccttc
ttcatcatcttcggcattctgggtgtgcagctcttcaagggcaagttctaccactgtttg
ggcgtggacacccgcaacatcaccaaccgctctgactgtgtggctgccaactaccgctgg
gtccaccacaagtacaactttgacaatctgggccaggccctaatgtccctctttgtcctg
gcctccaaggatggctgggtgaatatcatgtacaacggactggacgctgtcgctgtggac
cagcagcccgtgcccaaccacaacccctggatgctgctctacttcatctccttcctgctc
atcgtcagcttctttgtgcttaacatgttcgtgggcgtcgtggtggagaacttccacaag
tgccggcagcaccaggaggccgaggaggcgcggcgccgcgaggagaagcggctgcggcga
ctggagaagaagcgccggaaggcccagcggctgccctactatgccacctattgtcccacc
cggctgctcatccattccatgtgtaccagccactacctggacatcttcatcacctttatc
atctgcctcaatgtggtcaccatgtccctggagcactacaatcagcccacgtccctggag
acagccctcaagtactgcaactacatgttcaccactgtgtttgtgctggaggctgtgctg
aagctggtggcatttgggctaaggcgcttcttcaaggaccggtggaaccagctggacctg
gccattgtgctgctgtcggtcatgggcatcacgctggaggagattgagatcaacgcagca
ctgcccatcaaccccaccatcatccgcatcatgcgggttttgcgcatcgcccgggtgctg
aagctgttgaagatggccacggggatgcgggccctgctggacacggtggtgcaagctctg
ccccaggtgggcaacctgggccttctcttcatgctgctcttctttatctatgccgccctg
ggcgtggagctctttgggaagctagtctgcaatgacgagaacccatgcgaaggcatgagc
cggcatgccaccttcgagaactttggcatggccttcctcacgctcttccaggtctccact
ggcgacaactggaatgggatcatgaaggacacgttgcgggactgcacccatgacgagcgc
agctgcctgagcagcctgcagttcgtgtcgccgctgtacttcgtcagcttcgtgctcacg
gcccagttcgtgctcatcaacgtggtggtggccgtgctcatgaagcacctggacgacagc
aacaaggaggcccaggaggacgccgagatggatgccgagctggagctcgagatggcccac
ggcctggggcccagcccgcggccccccagcagctccccgggggcgcccggccgaggcccg
ggcggggcgggcggcggtggcgggggcgaccccgagggccgtctgtgccggcgctgctac
tctccggcccaggagaacctgtggctggacagcgtctctttaatcatcaaggactccttg
gagggggagctgaccatcattgacaacctgtctggctccatcttccatcactactcctcg
ccggccggctgtgagaagtgtcaccatgacaagcaagaggtgcagctggccgagacggag
gccttctccctaaactcagacaagtcctcctccatcctgctgggtgatgatctgagtctc
gaggatcccacagcctgcccagtcggccccaaagacagcaggggtgagccagacacacct
gagcccatgcaggtagaagaggtgggcgaatgcttcttccccttgtccaacacggctgtc
tcgtcggatcctgagaacttcctgtgggagaaggaggcggtcccatccaatcccgtccgg
tcctggctgaaacaggagagcagccgagctgcacccccgagtcccttctccccggatgcc
tccagcccgcttctgcccatgcctgcggagttcttccaccctgctgtgtctgccagccag
aaagggcaggacaagggtgctggcgctgggactctccccaagatcgccctgcagggctcc
tgggcatccctgcggtcgccgagtgtcaactgcaccctcctccggcaggccacagggagc
gacacgtcgctggaggccagccgcagcagctcggccggcagcctgcagaccacgctggag
gacagcctgaccctgagcgacagcccccggcgcgccctggggccgcccgccgccgccgcc
cccccgggcccccgcgccggcccgtcgccagccgcccgccgccccagcctgcgcggccgc
ggcccgttcagcctgcggggcctgcgcgcgcaccagcgcagccacagcagcggcggctcc
accagcccgggctgcacgcggcgcgactccttggacgcgtcggacgaggagggcgcgggc
ggccgcggcggcgcgggcggggagccctcggaggcgctcagcagcctgtcgctcaccgcc
ctgttcgcgccgccgccgccggggctcccgggcgcgcgccgctccagcagcaccagcagc
cgggccgccaaggcggcggcggccccggccccggccccggccccgacggcctcccccgag
ccgcagcccggccccggccccggccccgagcagcggcaggcgggggccgcggcgggcaag
cggaagagatga

DBGET integrated database retrieval system