KEGG   Canis familiaris (dog): 481271Help
Entry
481271            CDS       T01007                                 

Gene name
RAC2
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04010  MAPK signaling pathway
cfa04014  Ras signaling pathway
cfa04015  Rap1 signaling pathway
cfa04024  cAMP signaling pathway
cfa04062  Chemokine signaling pathway
cfa04071  Sphingolipid signaling pathway
cfa04310  Wnt signaling pathway
cfa04360  Axon guidance
cfa04370  VEGF signaling pathway
cfa04510  Focal adhesion
cfa04520  Adherens junction
cfa04650  Natural killer cell mediated cytotoxicity
cfa04662  B cell receptor signaling pathway
cfa04664  Fc epsilon RI signaling pathway
cfa04666  Fc gamma R-mediated phagocytosis
cfa04670  Leukocyte transendothelial migration
cfa04810  Regulation of actin cytoskeleton
cfa05200  Pathways in cancer
cfa05210  Colorectal cancer
cfa05212  Pancreatic cancer
cfa05231  Choline metabolism in cancer
cfa05416  Viral myocarditis
cfa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    481271 (RAC2)
   04015 Rap1 signaling pathway
    481271 (RAC2)
   04010 MAPK signaling pathway
    481271 (RAC2)
   04310 Wnt signaling pathway
    481271 (RAC2)
   04370 VEGF signaling pathway
    481271 (RAC2)
   04071 Sphingolipid signaling pathway
    481271 (RAC2)
   04024 cAMP signaling pathway
    481271 (RAC2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    481271 (RAC2)
   04520 Adherens junction
    481271 (RAC2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    481271 (RAC2)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    481271 (RAC2)
   04662 B cell receptor signaling pathway
    481271 (RAC2)
   04664 Fc epsilon RI signaling pathway
    481271 (RAC2)
   04666 Fc gamma R-mediated phagocytosis
    481271 (RAC2)
   04670 Leukocyte transendothelial migration
    481271 (RAC2)
   04062 Chemokine signaling pathway
    481271 (RAC2)
  Development
   04360 Axon guidance
    481271 (RAC2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    481271 (RAC2)
   05231 Choline metabolism in cancer
    481271 (RAC2)
   05210 Colorectal cancer
    481271 (RAC2)
   05212 Pancreatic cancer
    481271 (RAC2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    481271 (RAC2)
   05416 Viral myocarditis
    481271 (RAC2)
  Infectious diseases
   05163 Human cytomegalovirus infection
    481271 (RAC2)
GTP-binding proteins [BR:cfa04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    481271 (RAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf
Motif
Other DBs
NCBI-GeneID: 481271
NCBI-ProteinID: XP_538392
Ensembl: ENSCAFG00000001508
UniProt: E2RJH1
Position
10
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIERLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRPQKRPCSIL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagatggagccgtgggcaagacctgccttctc
atcagctacaccaccaacgctttcccaggagagtacatccccaccgtgttcgacaactac
tcggccaacgtgatggttgacagcaagccggtgaacttgggactgtgggacacggcagga
caggaggactacgaccgcctccggccactctcctacccgcagacggacgtcttcctcatc
tgcttctcccttgtcagccctgcctcctatgagaacgtcagagccaagtggttccctgag
gtgcgacaccactgccccagcacgcccatcatcctggtgggcaccaagctggatctgcgg
gacgacaaggacaccatcgagaggctgaaggagaagaagctggcgcccattacttacccg
cagggcctggccctggccaaggagatcgactctgtaaaatacctggagtgctcggccctc
acccagcgaggcctgaaaaccgtctttgatgaggcgatccgggcggtcctgtgcccccag
cccacgcggccacagaagcgtccctgcagcatcctgtag

DBGET integrated database retrieval system