KEGG   Canis familiaris (dog): 481318Help
Entry
481318            CDS       T01007                                 

Gene name
UXS1
Definition
(RefSeq) UDP-glucuronic acid decarboxylase 1 isoform X1
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00520  Amino sugar and nucleotide sugar metabolism
cfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    481318 (UXS1)
Enzymes [BR:cfa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     481318 (UXS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase UXS1_N NAD_binding_4 RmlD_sub_bind 3Beta_HSD Polysacc_synt_2
Motif
Other DBs
NCBI-GeneID: 481318
NCBI-ProteinID: XP_022280251
Ensembl: ENSCAFG00000002096
VGNC: 48220
Position
10
AA seq 386 aa AA seqDB search
MSFLLNRSIQENGELKIESKIEEIVEPLREKIRDLEKSFTQKYPPVKFLSEKDRKRILIT
GGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVD
QIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQ
SEDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVV
SNFILQALQGEPLTVYGSGSQTRAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEF
AQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIRKAKMMLAWEPVVPLEEGLNKAIHYFRKE
LEYQANNQYIPKPKPARIKKGRTRHN
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgagctttctactcaacaggtctatccaggaaaatggtgaactcaagatcgagagcaag
attgaggagatcgttgaaccactaagagagaaaatcagagatttggaaaaaagcttcacc
cagaaatacccgccagtaaaatttttatcagaaaaggaccgtaaaagaattttgataacc
ggaggagcagggttcgtgggttctcacctcaccgacaagctcatgatggatggccacgaa
gtgactgtggtggacaacttcttcaccggcaggaagaggaacgtggagcactggatcggc
catgagaactttgagctgataaaccacgacgtggtggagccactctacatcgaagttgac
cagatataccacctggcctccccagcctcccctccaaactacatgtataaccccatcaag
accctgaagaccaatacgatcgggacattaaacatgctgggactggcaaaacgagttggc
gctcgcctgctgctggcttccacctcagaggtgtatggagatcctgaagtccaccctcag
agtgaggattactggggccacgtgaaccccataggaccgcgagcctgctacgatgaaggg
aagcgtgttgccgagaccatgtgctatgcctacatgaagcaggaaggcgttgaagtgcgg
gtggccaggatcttcaacacctttgggccacgcatgcacatgaatgacggccgggtggtc
agcaacttcatcctgcaggcgctgcagggcgagccactcacggtgtatgggtccgggtcg
cagacaagggcattccagtatgtcagtgacctggtgaatggtctcgtggctctcatgaac
agcaacgtgagcagcccagtcaacctggggaacccggaagaacacacaatcctagagttt
gctcagttaattaaaaaccttgttggtagtggaagtgagattcagtttctctccgaagcc
caggatgacccacagaaaagaaaaccagatatcagaaaagcgaagatgatgctggcatgg
gagcctgtggtcccactagaagaaggtttaaacaaagcaatccactacttccgtaaagaa
ctcgagtaccaggcaaataatcagtacatccccaaaccaaagcccgcaaggataaaaaaa
ggacggacacgccataactga

DBGET integrated database retrieval system