KEGG   Canis familiaris (dog): 481331Help
Entry
481331            CDS       T01007                                 

Gene name
MAP4K4
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4 isoform X5
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    481331 (MAP4K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfa01001]
    481331 (MAP4K4)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     481331 (MAP4K4)
Protein kinases [BR:cfa01001]
 Serine/threonine kinases: STE group
  STE20 family
   481331 (MAP4K4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNH Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 481331
NCBI-ProteinID: XP_013972910
Ensembl: ENSCAFG00000002162
VGNC: 42984
Position
10
AA seq 1327 aa AA seqDB search
MDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITD
LVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVS
AQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCD
MHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNE
RQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQEGEPSSIVNVPGESTLRRD
FLRLQQENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRR
EREARRQQEREQRRREQEEKRRLEELERRRKEEEERRRAEEEKRRVEREQEYIRRQLEEE
QRHLEILQQQLLQEQAMLLECRWREMEEHRQAERLQRQLQQEQAYLLSLQHDHRRPHPQQ
PPPPQQERSKPSYHAPEPKPHYEPADRAREVEDRFRKTNHSSPEAQSKQTGRVLEPPVPS
RSESFSNGNSESVHPALQRPAEPQVQWSHLASLKNNVSPVSRSHSFSDPSPPKFAHHHLR
SQDPCPPSRSEVLSQSSDSKSEVPDPTQKAWSRSDSDEVPPRVPVRTTSRSPVLSRRDSP
LQGSGQQNSQAGQRNSTSSIEPRLLWERVEKLVPRPGSGSSSGSSNSGSQPGSHPGSQSG
SGERFRVRSSSKSEGSPSQRLENAVKKPEEKKEVFRPLKPAGEVDLTALAKELRAVEDVR
PPHKVTDYSSSSEESGTTDEEDDDVEQEGAEEATSGPEDTRAASSLNLSNGETESVKTMI
VHDDVESEPAMTPSKEGTLIVRQSTVDQKRASHHESNGFAGRIHLLPDLLQQSHSSSTSS
TSSSPSSSQPTPTMSPQTPQDKLTTNETQSASSTLQKHKSSSSFTPFIDPRLLQISPSSG
TTVTSVVGFSCDGMRPEAIRQDPTRKGSVVNVNPTNTRPQSDTPEIRKYKKRFNSEILCA
ALWGVNLLVGTESGLMLLDRSGQGKVYPLINRRRFQQMDVLEGLNVLVTISGKKDKLRVY
YLSWLRNKILHNDPEVEKKQGWTTVGDLEGCVHYKVVKYERIKFLVIALKSSVEVYAWAP
KPYHKFMAFKSFGELVHKPLLVDLTVEEGQRLKVIYGSCAGFHAVDVDSGSVYDIYLPTH
IQCSIKPHAIIILPNTDGMELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQ
TMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVYFMTLG
RTSLLSW
NT seq 3984 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcactgaggatgaagaggaagaaatcaaactggagataaatatgctgaagaaa
tattctcatcatagaaatattgcaacatattatggtgctttcattaaaaagagccctcca
ggacatgatgaccaactctggcttgttatggagttctgtggggctgggtccattacagac
cttgtgaagaacaccaaagggaacacgctcaaggaagactggatagcttacatctccaga
gaaatcctgaggggactggcacatcttcacatccatcacgtgattcaccgagacatcaag
ggccagaatgtgttgctgaccgagaatgcagaggtgaagcttgttgatttcggcgtgagt
gctcagcttgaccggaccgttgggaggagaaatacgttcataggcaccccctactggatg
gctcctgaggttattgcctgtgatgagaacccagatgccacctatgattacagaagtgat
ctttggtcttgtggcatcacagccattgagatggcagaaggtgctccccctctctgtgac
atgcatccaatgagagcactgtttctcattcccagaaaccctcctcccaggctgaagtca
aaaaaatggtcaaagaaattttttagttttatagaagggtgcctggtgaagaattacatg
cagcgaccctccacagagcagcttttgaaacatccttttataagggatcagccaaacgaa
aggcaagttagaatccagcttaaggaccatatagaccggaccagaaagaagagaggagag
aaagatgaaaccgaatatgagtacagtgggagtgaggaagaagaggaggaagtgcctgaa
caggaaggagagccaagctccattgtcaatgtgcctggtgagtcgacacttcgtcgggat
ttcttgagactgcagcaggagaacaaggaacgttctgaggctcttcggaggcagcagcta
ctgcaggagcagcagctccgggagcaggaagagtataagaggcagctactggcagagagg
cagaaacgcatcgagcagcagaaagaacagaggcggcgactagaagagcaacaaaggaga
gagcgggaagctagaaggcaacaagaacgtgaacagcgaaggagagaacaagaagagaag
aggcgtctggaggaactggagagaagacgtaaagaggaagaagagaggaggcgggcagag
gaagaaaagaggagagttgaaagagaacaggagtatatcaggcgacagctagaagaggag
cagcggcacttggaaatccttcagcagcagctgctccaggagcaggccatgttactggag
tgccgatggcgggagatggaggagcaccggcaggcagagaggctccagaggcagttgcaa
caagaacaagcatatctcctgtctctacagcatgaccacaggaggccgcacccgcagcag
ccgccgccaccgcagcaggaaaggagcaagccaagctatcacgctccggagcctaagccc
cactatgagcctgctgacagagctcgagaggtggaagatagatttaggaaaactaaccac
agctcccctgaagcccagtctaagcagacaggcagagtattggaaccaccagtgccttcc
agatcagagtctttttccaatggcaactccgagtctgtgcatcctgccctgcagagacca
gctgagccacaggtacagtggtcccacctggcatctctcaagaacaatgtttcccctgtc
tcgcgatcccattccttcagtgacccttctcctcccaaatttgcacaccaccatcttcgc
tctcaggacccatgtccaccttcccgcagtgaggtgctaagtcagagttctgactctaag
tcggaggtacctgaccccacccaaaaggcttggtctagatcagacagtgacgaggtgcct
ccaagggttcctgtgaggacaacgtctcgttcccctgttctgtcccgtcgggattcccca
ctgcaaggcagtggacagcaaaatagtcaagcaggtcaaagaaactccactagcagtatt
gagccccggctgctgtgggagagagtggagaagctggtgcccaggcctggcagtggcagc
tcctccggatccagcaactccggatcccagcctgggtcccaccctgggtcccagagtggc
tctggagagcgcttcagagtgagatcatcatccaaatctgaaggctctccttctcagcgc
ctagaaaatgcagtgaaaaaacctgaagaaaagaaagaagttttcagacctctcaagcct
gccggcgaagtggatttgactgcactggccaaagagcttcgagcagtggaagatgtgcga
ccaccacacaaagtgacagactactcctcatccagtgaggagtccgggacaacagatgag
gaagacgatgatgtagaacaagaaggggctgaggaagccacctctggaccagaggacacc
agagcagcgtcgtccctgaatttgagcaatggtgaaacagaatccgtgaaaaccatgatt
gttcatgacgacgtagaaagtgaaccagccatgaccccatccaaggagggcactctaatc
gtccgccagagtacagttgaccaaaagcgcgccagccatcatgagagcaatggctttgcc
ggtcgcattcacctcttgccagatctcttacagcaaagccattcctcctccacttcctcc
acctcctcctccccatcctccagccagccgacacccaccatgtccccacagacaccccag
gacaagctcactactaatgagactcagtccgctagtagcacactccagaaacacaaatct
tcctcctcctttacaccttttatagaccccagattactacagatttctccatctagtggg
acaacagtgacttctgtggtgggattttcctgtgatggaatgagaccagaagccataagg
caagatcctacccggaagggctcagtggtcaatgtgaatcccaccaacactaggccacag
agtgataccccggagattcgtaaatataagaagagatttaactccgagattctgtgtgct
gccttatggggagtgaatttgctagtgggtacagagagtggcctgatgctgctggacaga
agtggccaagggaaggtatatcccctgatcaaccgaagacgatttcagcaaatggatgtc
cttgaaggcttgaatgtcttggtgacaatatctggcaaaaaggataagttacgtgtctac
tatttgtcctggttaagaaataaaatacttcacaatgatccagaagttgagaagaagcag
ggatggacgactgtgggagatttggaaggatgtgtacactataaagttgtaaaatatgaa
agaatcaaatttctggtaattgctttgaagagttctgtggaggtctatgcgtgggcaccc
aagccatatcacaaatttatggcctttaagtcatttggggaattagtacataagccattg
ctggtggatctcactgtggaggaaggccagaggttgaaagtgatctatggatcctgtgct
ggattccatgctgttgatgtggattctggatcagtctatgacatttatctaccaacacac
atccagtgtagcatcaaaccccatgcaatcatcatcctccccaacacagatggcatggag
cttctggtgtgctatgaagatgaaggggtttatgtgaatacttatggaagaatcaccaag
gatgtggttctgcagtggggagagatgccaacatctgtagcatatattcgatccaaccag
acgatgggctggggagaaaaggccatagagatccgatctgtggaaactggtcatttggat
ggtgtgtttatgcacaaaagggctcaaagactaaaattcctatgtgaacgcaatgacaag
gtcttctttgcctctgttcggtctggtggcagcagccaggtttatttcatgacgttaggc
aggacttctcttctgagctggtaa

DBGET integrated database retrieval system