KEGG   Canis familiaris (dog): 481486Help
Entry
481486            CDS       T01007                                 

Gene name
ALDH7A1
Definition
(RefSeq) alpha-aminoadipic semialdehyde dehydrogenase
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00010  Glycolysis / Gluconeogenesis
cfa00053  Ascorbate and aldarate metabolism
cfa00071  Fatty acid degradation
cfa00260  Glycine, serine and threonine metabolism
cfa00280  Valine, leucine and isoleucine degradation
cfa00310  Lysine degradation
cfa00330  Arginine and proline metabolism
cfa00340  Histidine metabolism
cfa00380  Tryptophan metabolism
cfa00410  beta-Alanine metabolism
cfa00561  Glycerolipid metabolism
cfa00620  Pyruvate metabolism
cfa01100  Metabolic pathways
Module
cfa_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
cfa_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
cfa_M00555  Betaine biosynthesis, choline => betaine
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    481486 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    481486 (ALDH7A1)
   00620 Pyruvate metabolism
    481486 (ALDH7A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    481486 (ALDH7A1)
   00561 Glycerolipid metabolism
    481486 (ALDH7A1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    481486 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    481486 (ALDH7A1)
   00310 Lysine degradation
    481486 (ALDH7A1)
   00330 Arginine and proline metabolism
    481486 (ALDH7A1)
   00340 Histidine metabolism
    481486 (ALDH7A1)
   00380 Tryptophan metabolism
    481486 (ALDH7A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    481486 (ALDH7A1)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     481486 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     481486 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     481486 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 481486
NCBI-ProteinID: XP_538607
Ensembl: ENSCAFG00000000588
VGNC: 37789
Position
11
AA seq 539 aa AA seqDB search
MWRVPRQLCVRVASGGKLSGPRHRPAAFMSTLLINQAQYAWLKELGLREENEGVYNGSWG
GRGEVITTYCPANNEPIARVRQASVADYEETVKKAREAWKVWAEVPAPKRGEVVRQIGDA
LREKIQILGNLVSLEMGKILVEGVGEVQEYVDVCDYAVGLSRMIGGPILPSERPGHALIE
QWNPVGLVGIITAFNFPVAVYGWNNAIAMICGNVCLWKGAPTTSLISVAVTKIIAKVLED
NKLPGAICSLTCGGADIGTAMAKDERVNLLSFTGSTQVGRQVALMVQERFGRSLLELGGN
NAIIAFEDADLSLVVPSVLFAAVGTAGQRCTTARRLFLHESIHDEVVNRLKKAYEQIRVG
NPWDSDVLYGPLHTKQAVSMFLAAVEDAKKEGGTVVYGGKVMDRPGNYVEPTVVTGLAHN
ASIAHTETFAPILYVFKFKNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGI
VNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcgttccccgccagctgtgtgtgcgcgttgcaagcggaggcaagctctcgggc
cctcgccacagacccgctgccttcatgtccactctgctcatcaatcaggcccagtatgct
tggctgaaggagctggggctccgcgaggaaaacgagggcgtgtataatggcagctgggga
ggccgcggagaggttatcacgacctattgtccggctaacaatgaaccgatagcaagagtc
cgacaggccagtgtggctgactatgaagaaacagtgaagaaagccagggaagcctggaaa
gtctgggcagaggttcctgctccgaagcgaggagaagtagtgaggcagattggggatgct
ttgcgggagaagatccaaatactaggaaatttggtgtctttggagatggggaaaatctta
gtggaaggtgtgggagaagttcaagagtacgtggatgtttgtgattatgctgttggctta
tcacggatgattgggggacccatcttgccttctgaaagacctggccatgcgctcattgag
cagtggaatcctgtgggcctggttggcatcatcactgcgttcaacttccctgtggctgtg
tatggctggaacaatgccatcgcaatgatctgtgggaacgtatgcctttggaaaggagct
ccaacaacttccctcattagtgtagctgtcacaaaaataatagccaaggttctggaggac
aacaagctgcctggtgctatttgttccttgacctgtggtggagcagacattggcacagca
atggccaaagatgagcgggtgaacctgctgtccttcactgggagcacgcaagtgggaaga
caggtggcccttatggtgcaggagaggtttgggagaagcttgttagaacttggaggaaac
aacgccattattgcttttgaggatgcggacctcagcttagttgttccatcagtcctcttc
gcagctgtggggacagctggccagaggtgtaccacggcgaggcgcctgtttttacacgaa
agcatccatgatgaagttgtaaataggcttaaaaaggcctatgagcagatccgtgtgggg
aacccatgggactctgatgttctctatgggccactccacaccaaacaggcagtgagcatg
tttcttgcagcagtggaagatgcaaagaaagaaggtggcactgtggtctatggtggcaag
gtcatggatcgccctggcaattacgtagaaccaacagttgtgacaggtctggcccacaat
gcgtccattgcacacacagagacttttgctccgattctttatgtatttaaattcaagaat
gaagaagaagtctttgcatggaataatgaagtaaaacaaggactttcaagtagcatcttt
accaaggatttgggcagaatcttccgctggcttggaccgaaaggatccgactgtggcatt
gtaaatgtcaatatcccaacgagtggggctgagatcggaggtgcatttggaggagaaaag
cacactggtggtggtcgggagtccgggagtgatgcctggaaacagtacatgagaagatcc
acttgtactatcaactacagtaaggaccttcctctggctcaaggaatcaagtttcaataa

DBGET integrated database retrieval system