KEGG   Canis lupus familiaris (dog): 481496
Entry
481496            CDS       T01007                                 

Gene name
FNIP1
Definition
(RefSeq) folliculin-interacting protein 1 isoform X3
  KO
K20400  folliculin-interacting protein 1
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    481496 (FNIP1)
SSDB
Motif
Pfam: FNIP_M FNIP_C FNIP_N
Other DBs
NCBI-GeneID: 481496
NCBI-ProteinID: XP_003431674
Ensembl: ENSCAFG00000000755
VGNC: 40935
UniProt: A0A5F4DHC8
Position
11
AA seq 1140 aa
MAPTLFQKLFSKRSGLGAPGRDARDPDCAFSWPLSEFDPSQIRLIVYQDCERRGRNVLFD
SSVKRKSEDISVSKLCSDAQVKVFGKCCQLKPGGDSSSSLDSSMTSSSDVKDQCPKYQGS
RCSSDANMLGEMMFGSVAMSYKGSTLKIHQIRSPPQLMLSKVFTARTGSSICGSLNTLQD
SLEFINQDNSTLKADNNTVINGLLGNIVHSNPMDMPGRDLNEDRDSGIARSASLSSLLIT
PFPSPNSSLTRSCASSYQRRWRRSQTTSLENGVFPRWSIEESFNLSDESCGPNPGIVRKK
KIAIGVIFSLSKDEDENNKFNEFFFSHFPLFESHMNKLKSAIEQAMKMSRRSADASQRSL
AYNRIVDALNEFRTTICNLYTMPRIGEPVWLTMMSGTPEKNQLCHRFMKEFTFLMENASK
NQFLPALITAVLTNHLAWVPTVMPNGQPPIKIFLEKHSSQSVDMLAKTHPYNPLWAQLGD
LYGAIGSPVRLARTVVVGKRQDMVQRLLYFLTYFIRCSELQETHLLENGEDEAIVMPGTV
ITTTLEKGEIEESEYVLITMHRNKSSLLFKDPEETRTPNCNCKYCSRPLLGQNIENVSQQ
EREDIQNSSKELLGISDECQMISPSDCQDENAVDVKQFRDKLRTCLDTKLETVVCTGSAP
VDKCALSKSGLEPAEETWHSEELLSSGNHTGKVLRSTGMVVEKKPPDKLVTAAFSCEASQ
TKVTFLIGDSMSPDSDTELRSQAVVDQITRHHTKPLKEGGANDQQHQETKQTTVKDQSGE
SDIPNMVSGETCELPCWNHSDPESMSLFDEYFNDDSIETRTIDDIIAVKTSTDIKEHCCM
LEFSKGLCTKNSQQNSEFCKCVEKVHQDSCKTCFPQQDQRDTLSILVPHGDKESSEKKIA
VGTEWDIPRNESSDSALGDSESEDTGHDMTRQVSSYYGGEQEDWAEEDEIPFPGSKLIEV
SAVQPNIANFGRSLLGGYCSSYVPDFVLQGIGSDERLRQCLVSDLSHAVQHPVLDEPIAE
AVCIIADMDKWTVQVASSQRRMTDNKLGKEVLVSSLVSNLLHSTLQLYKHNLSPNFCVMH
LEDRLQELYFKSKMLSEYLRGQMRVHVKELGVVLGIESSDLPLLAAVASTHSPYVAQILL
NT seq 3423 nt   +upstreamnt  +downstreamnt
atggcccctacgctgttccagaagctcttcagcaagaggagcgggctgggcgcgcccggt
cgggacgcgcgggacccggactgcgcgttcagttggcctttgtcagagtttgatccaagc
caaattcgactgattgtatatcaagactgtgaaagacgagggagaaatgtcttgtttgac
tccagtgttaagagaaaaagtgaggacatatcagtatcgaaactctgtagtgatgctcaa
gtaaaagtctttgggaaatgctgccaactgaaacctggaggagacagttcttcctcattg
gatagttctatgacttcatcttctgatgtaaaagaccagtgtcctaagtaccaaggttct
cggtgctcttctgatgccaatatgcttggagagatgatgtttggctctgtagcaatgagc
tacaaagggtccaccttaaaaattcatcagatccgttcccctccacaacttatgctcagc
aaagtttttactgcacgaactggcagcagtatctgtggaagtctcaatacgcttcaagac
agtcttgaattcatcaatcaggacaacagtacattaaaggctgataataacacagttatt
aatggactacttggaaatatagttcacagcaacccaatggacatgcctggaagagacctg
aatgaggacagagacagtggaatagcacgctctgcatctctcagcagtttgcttattacg
ccgtttccctctccaaactcctcacttacccgaagttgtgccagcagttaccagcgacgt
tggcgacgcagccaaacaacaagtttggagaatggggtatttccaagatggtctatagaa
gaaagctttaatctgtcagatgaaagctgtggccctaacccaggaattgtgaggaaaaag
aagattgcaattggggtaatcttttcattatccaaagatgaagatgaaaataacaaattt
aatgaattctttttttcacattttcctctctttgaaagccacatgaacaaactaaagagt
gcaatagaacaggctatgaaaatgagccggagatcagctgatgccagtcagaggagtttg
gcatataatcgaatagttgatgccctaaatgaattcagaacaacaatttgtaatctttac
acaatgccacgaattggagagcctgtctggcttacaatgatgtcggggactccagaaaag
aaccagctttgtcatcgtttcatgaaggagttcacttttctaatggaaaatgcttccaaa
aatcaattcctgccagcactcattactgcagttctgaccaatcatcttgcctgggttcca
acggtcatgccaaatggacagccacctataaaaatatttttagaaaagcattcctcccag
agtgtggacatgttagcaaaaactcatccgtataacccactttgggcacaactaggggac
ttgtatggcgctattggttctcctgtacgattagcgaggactgtggtggttggcaaacga
caagacatggtccagaggctgctttattttcttacttattttataagatgctctgaactt
caagaaactcatcttttagaaaatggagaagatgaagccatcgttatgccaggcacagta
attactacaactttagagaaaggtgaaatcgaagaatctgagtatgtgcttatcacaatg
catagaaacaaaagcagtttgctttttaaagacccagaagaaacaaggactcctaactgt
aactgtaaatattgcagtcgtccactccttgggcaaaatatagagaatgtttcacaacaa
gagagagaagatattcaaaacagctctaaggagctgctaggaatttcagatgagtgtcaa
atgatttctccctctgactgccaagatgaaaatgctgttgatgttaaacagttcagagat
aaattaagaacttgccttgacactaagttagagacagttgtttgcacaggatctgctcca
gtagacaaatgtgccttgtcaaaatcaggcttagagccagcagaggaaacatggcatagt
gaggaattgctgagttcaggtaatcacacaggcaaagtgttgagatccacaggaatggtt
gtggaaaaaaaacctccagataagcttgtgactgctgcgttttcttgtgaagcatcacag
acaaaggttaccttcctgattggagattctatgtcacctgactccgatactgaactcagg
agtcaggctgtggtggatcagattaccaggcaccacaccaaaccactgaaggaaggaggg
gctaatgatcagcagcatcaagaaactaaacaaacaactgttaaggaccaatccggagag
tctgatataccaaacatggtttctggagagacctgtgaacttccctgttggaatcattca
gatccagaaagcatgagcttatttgatgaatattttaatgatgattcaattgaaaccagg
actattgatgatattattgcagttaaaacaagtacagacattaaggaacactgctgtatg
ttagaattttcaaaaggattgtgtacaaaaaatagccaacagaacagtgaattttgtaaa
tgtgtagaaaaagttcaccaggattcatgtaaaacctgctttcctcagcaggaccaaaga
gatacactctccattcttgtcccccatggggataaagagagttcagagaaaaaaattgct
gtaggaactgaatgggacattccaagaaatgaaagttcagatagtgcccttggggatagt
gaaagtgaagatacaggtcatgatatgactagacaagtaagcagttactatggaggagag
caagaagattgggcagaagaggatgagataccttttcctgggtcaaagttaattgaagtg
agtgctgttcagcccaacattgccaactttgggaggtccttgttgggtggctactgctcc
tcttatgtgcctgactttgttcttcaaggaattgggagtgatgagaggctccgtcagtgt
ctggtatcagatttgtctcatgctgtgcagcatccagtgttggatgaaccaatagcagaa
gctgtctgtattatagcagatatggataaatggactgttcaagtggccagtagccagaga
cggatgacagataataaattgggaaaggaagtattggtttccagtcttgtgtccaacctg
cttcattccactcttcagctttataaacataacttgtctccaaatttttgtgtaatgcat
ctagaagaccgattacaggagttatacttcaagagcaaaatgctatctgagtacctgagg
ggacagatgcgtgttcacgtcaaggaactaggagtggttctagggattgaatccagtgat
cttcctcttctggctgctgtagcaagcactcattctccatatgttgctcagatactcctt
taa

DBGET integrated database retrieval system