KEGG   Canis familiaris (dog): 481502Help
Entry
481502            CDS       T01007                                 

Gene name
SHROOM1
Definition
(RefSeq) protein Shroom1
  KO
K18625  protein Shroom
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cfa04812]
    481502 (SHROOM1)
Cytoskeleton proteins [BR:cfa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     481502 (SHROOM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ASD2 ASD1 Arabinose_Iso_C
Motif
Other DBs
NCBI-GeneID: 481502
NCBI-ProteinID: XP_013973192
Ensembl: ENSCAFG00000000914
VGNC: 46156
UniProt: E2RTB7
Position
11
AA seq 858 aa AA seqDB search
MEAPGPGGDRASPASSTRSLDLRRLSARADSAYSSFSAASAAPEPEPRTPSPGTDLLPYL
DWDYVRVVWGGPGPAGSLRASAQPRPAAAARSGPRPPEVQGTPGPLSRQATPLLFALAAE
AEAEAAARLVEPPSPPASRAAYRQRLQGAQRRVLRETSFQRKELRMSLPGRLRPAAPARP
PAAHPRSASLSHPAGGGGGGGGEVEPARPGATAARADVGRGRLATQQRQWCFSEPGKLDR
VGRGGGAAGERSGEAACSSGIARPGTRERRVLAQFQGHQTRRLPESPPRGTEDPESGSAK
LGDAYRPSGRSQSQSASGEVLAPWGGPGGVMPIVQAVPQGAETPRPLFQAQLARFLTQKE
AAVVCSAVYPQSSPADCEQRASETCIGCTRLPSLPDDEVFLEEVPLAKMRSPLDTHTCPE
SPTSIYVSDQRYGTGSGQRADQATDSPENPLHEHPETARADDCHQRIHGSVGVSGTIYYR
PPGTANGDIATFHTNGLLTIDSLAATESDPLKPLPVDVLGPPSNNTPGAPGCTAEALAAG
QPGSRPTWPSPRLEELVQELARLDPSMSDTLTSCPSPEPPLDLLDGLIPLAEVWAAMRPA
CKEAGKEAAGSPEPGSSQLLPTSQEETRFENQTTRSVPDQACGEHLPDPNSSIQAKKMEL
ADLLQTMLRNLQAEQEQLHQAAQAWARRGAALEAAVGQACAPRDLERFSRFMADIERVLG
LLLLLGSRLGRVRRALARAGADSDPDEQASLLQRLGLLQRQQEDAKELKEHVARRERALR
EVLVQALPPEELSAYHSLLVGKAAVLAQQRSLDERVRLLQDQLDAVRSDLGPHPLPPRLA
WLPEACLPDKPPFLPPLI
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atggaggccccagggcccgggggcgaccgcgcctccccagcctcgtccacccgcagcctg
gacctgcggcggctgtccgcgcgcgccgactcggcctacagctccttctccgcggcctcc
gcggcccccgagccggagccgcgcacgccgtcgcccgggaccgacctcctcccttaccta
gactgggactacgtgcgcgtggtgtggggtggcccgggccccgccggcagccttcgcgcc
tccgcgcagccccggcccgcggccgccgcgcgcagtgggccgcggccgcccgaggtccag
ggcacgccggggccgctcagccggcaggccaccccgctgctctttgcgctggcggccgag
gccgaggcggaggcggcggcgcggctcgtggagccgcccagcccaccggcctcgcgggcc
gcgtaccgccagcggctgcagggcgcccagcggcgagtgctccgggagacgtccttccag
cgcaaggagctccgcatgagcctgcccggccgcctgcggcccgcggcccccgcgcggccc
cccgcggcgcacccgcgctccgcctcgctcagccacccggccggcgggggcgggggcggg
ggcggggaggtggagcccgcgcgccccggggccaccgccgcccgggcagacgtgggccgg
gggcgcctcgccacccagcagcggcagtggtgcttctccgagccggggaagctagatcgc
gtggggcggggcggtggggcggccggggaacgctccggtgaggccgcctgcagttctggc
atcgccaggcccgggacccgggagcggagggtgctggcgcaattccaaggccaccagacc
agacggctgcctgagtcgccgccccgaggcacagaggacccagaatccgggtccgcgaag
cttggtgacgcctataggccctccggtcggagtcagagtcagagcgcgtcaggggaagtc
ttggctccctggggaggtccaggaggggtcatgcccattgtccaggctgttccccaagga
gcagaaacccccagaccattgtttcaggcccaacttgccaggttcctgactcagaaggaa
gctgcagtggtttgttctgcagtgtatccccaaagtagccctgctgactgtgaacagaga
gcctcagagacatgcattgggtgtacccggctcccatcccttccagatgatgaggttttc
ctggaagaagtccccctggccaaaatgagatcacctctagacacccatacctgcccagaa
agcccaaccagtatctatgtctctgaccagcggtatggaactggctcaggccagagggct
gaccaggctacagactccccagagaatcccctccatgaacacccagagactgcaagggca
gatgactgccaccagaggatacatggttctgtgggtgtctctgggaccatatactatagg
ccccctgggactgcaaatggtgacatagcaacctttcacaccaatggactgctgaccatt
gactcacttgcagctacagagagtgacccgctcaaacctctcccagttgatgtcctcgga
cctccaagcaacaataccccaggtgctcctggctgtactgccgaggctttggccgctggc
cagcccggttctaggccaacatggcccagtcctcgccttgaggagctggttcaggagctg
gccagactggatccctctatgagtgacactctcacttcctgtcccagcccagagccaccc
ctggaccttctagatgggctgattcctttagccgaggtctgggctgcaatgaggccagcc
tgtaaggaggctgggaaagaggctgctggtagtcctgagccaggctccagccagctcctg
ccaacttctcaggaggagacaaggtttgaaaaccagaccacccgctctgtgcctgaccag
gcctgtggcgagcatctccctgatccaaatagcagcatccaagccaagaagatggagcta
gccgacctcctccaaacgatgctgcggaaccttcaggccgagcaggagcagctgcaccag
gcggcccaggcttgggccaggcgcggggctgctctggaggccgcggtggggcaggcctgc
gctccccgtgacctagagcggttcagcaggttcatggccgacatagagcgtgtgcttggc
ctgctgctgctgctgggcagtcgcctgggccgcgtgcggcgcgccctggcccgggcaggt
gcggacagcgacccagatgagcaggcctctctgctgcagcgtctggggctcctgcagcgg
cagcaggaagatgccaaggagctgaaggagcacgtggcgcggcgcgaacgggccctgcgc
gaagtgctggtgcaggccttgccccccgaggagctgagcgcctatcactccctgctggtc
ggcaaggcggccgtcctggcccagcagcgcagcctggatgagcgtgtccggctccttcag
gaccagctcgacgcagtcaggagcgaccttggccctcatcccctgcctcccaggctggcc
tggctcccagaggcctgtcttcctgataaaccgcccttcctgccacccctcatctaa

DBGET integrated database retrieval system