KEGG   Canis lupus familiaris (dog): 481705
Entry
481705            CDS       T01007                                 

Gene name
PPP1R10
Definition
(RefSeq) serine/threonine-protein phosphatase 1 regulatory subunit 10
  KO
K17552  protein phosphatase 1 regulatory subunit 10
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cfa01009]
    481705 (PPP1R10)
Protein phosphatases and associated proteins [BR:cfa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     481705 (PPP1R10)
SSDB
Motif
Pfam: Med26 zf-CCCH zf-CCCH_4 zf-CCCH_2 zf_CCCH_4
Other DBs
NCBI-GeneID: 481705
NCBI-ProteinID: XP_848400
Ensembl: ENSCAFG00000000406
VGNC: 44876
UniProt: F6XDS1
Position
12
AA seq 940 aa
MGSGPIDPKELLKGLDSFLNRDGEVKSVDGISKIFSLMKEARKMVSRCTYLNILLQTQSP
EILVKFIDVGGYKLLNNWLTYSKTTNNIPLLQQILLTLQHLPLTVDHLKQNNTAKLVKQL
SKSSEDEELRKLASVLVSDWMAVIRSQSSTQPAEKDKKKRKEEGKSRTTPPERPLTEVKA
ETRAEEAPEKKKEKPKSLRTTAPSHAKFRSTGLELETPSLVPVKKNASAVVVSDKYNLKP
IPLKRQSTTVAPGDGAPPAEKKYKPLNTTPNATKEIKVKIIPPQPMEGLGFLDALNSAPV
PGIKIKKKKKVLSPTAAKPSPFEGKTSTEPSTAKPSSPEPAPTCEAMDTDRPGTPVPPVE
VPELMDTASLEPGALDAKPVESPGDPSQLTRKGRKRKTVTWPEEGKLREYFYFELDETER
VNVNKIKDFGEAAKREILSDRHAFETARRLSHDNMEEKVPWVCPRPLVLPSPLVTPGSNS
QERYIQAEREKGILQELFLNKESPHEPDPEPYEPVPPKLIPLDEECSMDETPYIETLEPG
GAGGSPDGAGGSKLPPVLANLMGSMGAGKSPQGPGGGGINVQEILTSIMGSPNSHPSEEL
LKQPDYSDKIKQMLVPHGLLGPGPIANGFPPGGPGGPKAMQHFPPGPGGPIPGPHGGPGG
SVGPRLLGPPPPPRGGDPFWDGPGDPMRGGPMRGGPGPGPGPYHRGRGGRGGNEPPPPPP
PFRGARGGRSGGGPPNGRGGPGGGMVGGGGHRPHEGPGGGMNSSSGHRPHEGPGGGMGGG
HRPHEGPGSSMGGGGGHRPHEGPGGGMGSGSGHRPHEGPGSGMGGGSGHRPHEGPGGGMG
AGGGHRPHEGPGHGGPHGHRPHDVPSHRGHDHRGPPPHEHRGHDGPGHGGGGHRGHDGGH
SHGGDMSNRPVCRHFMMKGNCRYENNCAFYHPGVNGPPLP
NT seq 2823 nt   +upstreamnt  +downstreamnt
atgggttcgggtcccatagatcccaaagagcttctcaagggcctggatagcttccttaac
cgagatggggaagtcaagagtgtggatgggatttccaaaatcttcagcctgatgaaggaa
gcacgaaagatggtgagtcgatgcacttacttgaacattctcctgcagacccagtcacca
gaaatattggtcaagtttattgatgttggtggctacaagcttcttaacaactggctgact
tattcaaagacaaccaacaacattcccctcttgcagcaaattctgcttaccctgcagcac
ctcccgctcaccgtggaccatctcaagcagaacaacacagccaaactggtgaagcagctg
agcaagtcaagtgaggatgaagagctccggaaattggcttcagtccttgtcagtgactgg
atggctgtcatccgctcccagagcagtacccagcctgctgagaaagataagaaaaaacgt
aaagaagaggggaagagtcgaaccacccctcccgagcgacccttgactgaggtgaaggct
gagacccgggctgaggaggccccagagaagaagaaagagaagcccaagtctctccgaacc
acagcacccagtcacgccaagtttcgttccactgggctagagctggagaccccatctttg
gtgcctgtgaaaaagaacgccagtgcagtggtggtttctgacaagtacaatcttaaaccc
atccccctcaagcgtcagagcaccacagttgctccaggagatggtgctccccctgcagag
aagaaatacaagccactgaacaccacaccaaatgccaccaaagagatcaaagtgaagatc
atcccaccacagcctatggagggcctgggcttcctggatgcactcaattcagcccctgtt
ccaggcatcaaaattaagaagaagaagaaggtgttgtcacccacagctgccaagccaagc
ccgtttgaagggaaaacgagcacagaaccgagcacggccaaaccttcttccccagaacca
gcaccaacttgtgaggctatggacacagatcgcccaggaaccccagttccccctgttgaa
gtcccagagctcatggatacagcctctttagagccaggagcgctggatgcaaagcccgtg
gagagtcccggagatcccagccagctgacccggaaaggcaggaagaggaagacggtgaca
tggcctgaggagggcaaactgagagaatatttctattttgaactggatgaaactgaacga
gtaaatgtgaataagatcaaggactttggtgaggcagctaagcgagagatactgtcagac
cgacatgcatttgagacggcccggcgtctgagccatgacaacatggaggagaaggtgccc
tgggtgtgcccccggcccctggttctgccctcacctcttgtcacccctggaagcaacagc
caggagcgatacatccaggctgagcgggagaaaggaatccttcaggagctcttcctgaac
aaggaaagtcctcatgaacctgatcctgaaccctatgaacctgtacccccaaagctcatc
cccctagatgaggaatgttccatggatgagaccccatatattgagaccctggagcctggg
ggagctggtggctcacctgatggagcaggtggctccaagttgcctcctgtcctggccaat
ctcatgggaagcatgggtgctgggaagagcccccagggtcctggaggaggaggcatcaat
gtccaagagatcctcacctccatcatgggtagcccaaatagtcatccctcagaggaactg
ctaaagcaaccagactattcagacaagatcaagcagatgctcgtgccacatggattatta
ggccctggtccaatagccaatggtttcccaccaggaggtcctgggggtcccaaggccatg
cagcacttcccccctggacctggaggacctataccaggtcctcatggaggccctggtggg
tcagtgggtccgcgtctcttgggtcccccaccccctccacgagggggtgatcccttctgg
gatggcccaggtgaccccatgcgaggtggcccaatgcggggtggcccaggaccaggtcct
ggaccataccatagaggccgtggtggccgaggaggaaatgaaccacctcctcctcctcct
cccttccggggggccaggggaggtcgctctggaggaggacctccaaatggacgagggggc
cctggtgggggcatggttggaggtggtggtcatcgtccacatgaaggccctggtgggggc
atgaacagcagcagtggacatcgtcctcatgaaggccctggtggtggtatgggtggtggg
catcgcccccacgaaggccctggcagtagcatgggtggaggtgggggacatcgtcctcac
gaaggccctggtggtggcatgggcagtggcagtggccatcgtcctcatgaaggccctggc
agtggcatgggtggaggcagtggacatcgcccccatgaaggtcctggtggaggaatgggt
gctggtggtggacatcgcccccatgaaggtcctggacatggggggccccatggccaccgg
cctcatgatgtccctagtcaccgaggccatgaccatcgagggccaccacctcatgagcac
cgtggccatgatggccctggccacggaggagggggccaccgagggcacgatggaggccac
agccacggaggagatatgtccaaccgccctgtgtgccgacatttcatgatgaagggcaat
tgccgctatgagaacaactgtgccttctaccacccgggtgtcaatgggccccccctgccc
tag

DBGET integrated database retrieval system