KEGG   Canis familiaris (dog): 481756Help
Entry
481756            CDS       T01007                                 

Gene name
PPARD
Definition
(RefSeq) peroxisome proliferator-activated receptor delta
  KO
K04504  peroxisome proliferator-activated receptor delta
Organism
cfa  Canis familiaris (dog)
Pathway
cfa03320  PPAR signaling pathway
cfa04310  Wnt signaling pathway
cfa05200  Pathways in cancer
cfa05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    481756 (PPARD)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    481756 (PPARD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    481756 (PPARD)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    481756 (PPARD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cfa03000]
    481756 (PPARD)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:cfa03310]
    481756 (PPARD)
Transcription factors [BR:cfa03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone-like
    481756 (PPARD)
Nuclear receptors [BR:cfa03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   481756 (PPARD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep DUF1845
Motif
Other DBs
NCBI-GeneID: 481756
NCBI-ProteinID: NP_001041567
Ensembl: ENSCAFG00000001310
VGNC: 44835
UniProt: Q0ZAQ8
Position
12
AA seq 441 aa AA seqDB search
MEQPPGEAAEVREEEEKKEVAEAEGAPELNGGPERSLPSSSYTDLSRSSSPPSLLDQLQM
GGDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERICKIQKK
NRNKCQYCRFQKCVALGMSHNAIRFGRMPEAEKRKLVAGLTANEGTQHNPQVADLKAFSK
HIYNAYLKNFNMTKKKARGILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKE
ISVHVFYRCQCTTVETVRELTEFAKSIPSFSNLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGTGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGD
RPGLINVPQVEAIQDTILRALEFHLQANHPYAQYLFPKLLQKMADLRQLVTEHAQMMQRI
KKTETETSLHPLLQEIYKDMY
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggagcagccaccgggggaagccgctgaggtccgggaagaggaggagaaaaaggaagtg
gcagaggcagaaggagccccagagctcaatggaggaccagagcgctcgcttccttccagc
agctatacagacctctcccggagctcctcgccaccatcactgctggaccagttacagatg
ggcggtgatggggcatcgtgtggcagcctcaacatggagtgccgtgtgtgcggggacaag
gcatcgggcttccactacggtgtccatgcgtgtgaggggtgcaagggcttcttccgtcgg
acgatccgcatgaagctggaatatgagaagtgcgagcggatctgcaagatccagaagaag
aaccgcaacaagtgccagtactgccgcttccagaaatgcgtggcactgggcatgtcgcat
aatgccatccgctttggccggatgccagaggccgagaagaggaagctggtggcagggctg
acagcaaacgaggggactcagcacaacccacaggtggctgacctgaaggccttctccaag
catatctacaacgcctacctgaaaaacttcaacatgaccaaaaagaaggcccgtggcatc
cttacgggcaaggccagccacacggcgccctttgtcatccacgacatcgagacgttgtgg
caagcagagaagggcctggtgtggaagcagctggtgaacggcctgccaccctacaaggag
atcagcgtgcacgtcttctaccgctgccagtgcaccacagtcgagactgtgcgtgagctt
acggagtttgccaagagcatccccagcttcagcaacctcttcctcaacgaccaggtgacc
cttctcaagtatggtgtacacgaggccatattcgccatgctggcctccatcgtcaacaag
gacggcttactggtggccaatggcaccggttttgtcacccgtgagttcttgcgaagcctc
cgaaaacccttcagtgacatcatcgagcccaagtttgagtttgctgtcaagttcaatgcc
ctggaacttgatgacagtgacttggctctcttcattgcagccatcattctctgtggagac
cgaccaggcctcataaacgtgccccaggtggaggccatccaggacaccatcctgcgtgcc
ctcgagttccacctgcaggccaaccacccctacgcccagtacctcttccccaagctgctg
cagaagatggccgacctgcggcagttggtcaccgagcacgcgcagatgatgcagcgcatc
aagaagaccgagacggagacctcgctgcaccccctgctccaggagatctacaaggacatg
tactaa

DBGET integrated database retrieval system