KEGG   Canis familiaris (dog): 481837
Entry
481837            CDS       T01007                                 

Gene name
IL17A
Definition
(RefSeq) interleukin-17A precursor
  KO
K05489  interleukin 17A
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04060  Cytokine-cytokine receptor interaction
cfa04657  IL-17 signaling pathway
cfa04659  Th17 cell differentiation
cfa05321  Inflammatory bowel disease
cfa05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    481837 (IL17A)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    481837 (IL17A)
   04657 IL-17 signaling pathway
    481837 (IL17A)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    481837 (IL17A)
   05321 Inflammatory bowel disease
    481837 (IL17A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cfa04052]
    481837 (IL17A)
Cytokines and growth factors [BR:cfa04052]
 Cytokines
  Interleukins
   481837 (IL17A)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 481837
NCBI-ProteinID: NP_001159350
Ensembl: ENSCAFG00000028874
VGNC: 41942
UniProt: C6L8D7
Position
12
AA seq 155 aa
MTLVTTSSMFQSLLLLLSLVAIIKAGIAFPQNPGCRNTEDKNFPQHVKVNLNILNRNTNS
RRPSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNNEGNINYHMNSVPIQQEIL
VLRRESQHCPHSFRLEKMLVAVGCTCVTPIVRHVA
NT seq 468 nt   +upstreamnt  +downstreamnt
atgactctggtgacaacttcatccatgttccagtcactgctactgcttctgagcctggtg
gctatcataaaggcaggaatagcattcccacaaaatccaggatgccgaaatactgaggac
aagaactttcctcagcatgtgaaggtcaatctaaatatccttaaccggaatacgaactcc
agaaggccctcagattactacaaccgatctacctcaccttggaatctgcaccgcaatgag
gaccctgagagatacccctctgtgatctgggaggcgaagtgccgccacttgggctgtgtc
aataatgaagggaacataaactaccacatgaactccgtccccatccagcaagagatcctg
gttctgcgaagggagtcgcagcactgcccccactccttccggctagagaagatgctggtg
gctgtgggctgcacctgtgtcacccctattgttcgccatgtggcttaa

DBGET integrated database retrieval system