KEGG   Canis lupus familiaris (dog): 481881
Entry
481881            CDS       T01007                                 

Gene name
COL12A1
Definition
(RefSeq) collagen alpha-1(XII) chain isoform X1
  KO
K08132  collagen type XII alpha
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    481881 (COL12A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:cfa00535]
    481881 (COL12A1)
Proteoglycans [BR:cfa00535]
 Extracellular matrix (ECM) proteoglycans
  Collagen family
   481881 (COL12A1)
SSDB
Motif
Pfam: fn3 VWA VWA_2 Pur_ac_phosph_N Collagen Interfer-bind DUF4998 Copine Toxin_R_bind_N
Other DBs
NCBI-GeneID: 481881
NCBI-ProteinID: XP_005627591
Ensembl: ENSCAFG00000002702
VGNC: 39458
UniProt: A0A5F4BY69
Position
12
AA seq 3122 aa
MRTGLPPALAALGAALLLSSIEAEVDPPSDLNFKIIDENTVHMSWARPADPIVGYRITVD
PTTDGPTKEFTLAASTTETLLSDLIPEIEYVVTITSYDEVEESVPVIGQLTIQTGGPTKP
GEKKPGKPEIQKCSVSAWTDLVFLVDGSWSVGRNNFKYILDFIGALVSAFDIGEEKTRVG
VVQYSSDTRTEFNLNQYYRTDELLAAIKKIPYKGGNTMTGDAIDYLIKNTFTESAGARVG
FPKVAIIITDGKSQDEVEIPARELRNIGVEVFSLGIKAADAKELKQIASTPSLNHVFNVA
NFDAIVDIQNEIISQVCSGVDEQLGELVSGEEVIEPPSNLVATEVSSKYIKLSWSPSPSS
VTGYKVLLTPMTAGSRQHALSVGPQTTTLSVRDLSADTEYQISISAMKGLTSSEPVSIME
KTQPMKVQVECSRGVDIKADIVFLVDGSYSIGIANFVKVRAFLEVLVKSFEISPNRVQIS
LVQYSRDPHTEFTLKKFTKVEDIIEAINTFPYRGGSTNTGKAMTYVREKIFVPSKGSRGN
VPKVMILITDGKSSDAFRDPAIKLRNSDVEIFAVGVKDAVRSELEAIASPPAETHVFTVE
DFDAFQRISFELTQSICLRIEQELAAIKKKAYVPPKDLSFSETTSYSFKANWSPAGENVF
SYHITYKEATGDDEVTVVEPASSTSVVLNNLKPETLYLVNVTAEYEDGFSVPLTGEETTV
EVKGAPRNLKVTDETTDSFKITWTQAPGRVLRYRIIYKPVASGESKEVTTPANQRRITLE
NLTPDTKYEVSVIPEYFSGPGSPLTGNAATEEVRGTPRDLRVSDPTTSTMKLSWTRAPGK
VKQYLVTYIPAAGGETQEVTVRGDTTSTVLRGLNEGTQYALSVTALYASGAGDALYGEGM
TLEERGSPKDLVTKDITDTSIGAYWTSAPGMVRGYRVSWKSLYDDIETGEKSLPGDAIHT
VIENLQPETKYKVSVFAVYSSGEGEPLNGEATTELSQDSKTLKVDEETENTMRVTWKPAP
GKVINYRVVYRPRGGGRQMVAKVPPTVTSTVLKRLQPQTTYDITVLPMYKTGEGKLRQGS
GTTASRFKSPRNLKTSDPTMSSFRVTWEPAPGEVKGYKVTFHPTGDDRRLGELVVGPYDN
TVVLEELRAGTTYKVNVFGMFDGGESSPLVGQEMTTLSDTTVMPILSSGMECLTRAEADI
VLLVDGSWSIGRANFRTVRSFISRIVEVFEIGPKRVQIALAQYSGDPRTEWQLNAHRDKK
SLLQAVANLPYKGGNTLTGMALNFIRQQNFRTQAGMRPRARKIGVLITDGKSQDDVEAPS
KKLKDEGVELFAIGIKNADEDELKMIATDPDDTHAYNVADFESLSKIVDDLTINLCNSVK
GPGDLEAPSNLVISERTHRSLRVSWTPPSDSVDRYKVEYYPVSGGKRQEFYVSRLESSTV
LKDLKPETEYVVNVYSVVEDEYSEPLKGTEKTLPVPVVSMNIYDISPTTMHVQWQPVGGA
TGYTLSYEPINGTEPTKPKEMRVGPTVNDVQLTDLSPNTEYAVTVQAALHDLTSEPVTAR
EVTLPLPKPRDLRLRDVTHSTMNVLWEPAPGKVRKYIVRYKTPEEDVKEVEVDRSRTSTP
LRDLFSQTLYTVDVSAIYDEGESPPVTAQETTRTVPAPTNLKITEVTPESFRGTWDHGAS
DVSLYRITWAPFGSSDKMETILNGDENTLVFENLNPNTLYEVSVTAIYPDESESDDLTGS
ERTPRLIPLTTQAPKSGPRNLQVYNATSNSLTVKWDPASGRVQKYRITYQPSTGEGNEQT
TTIGGRQNSVVLQKLKPDTPYTITVSSLYPDGEGGRMTGRGKTKPLNTVRNLRVYDPSTS
TLNVRWDHAEGNPRQYKLFYAPTAGGPEELVPIPGNTNYAILRNLQPDTPYTVTVVPVYT
EGDGGRTSDTGRTLVRGLARNVQVYNPTPNSLDVRWDPAPGPVQQYRIVYSPVAGTRPSE
SIVVPGNTRTVHLERLIPDTPYSVNIVALYSDGEGNPSPGQGRTLPRSGPRNIRVFGETT
NSLSVAWDHADGPVQQYRIIYSPTVGDPIDEYTTVPGRRNNVMLQPLQPDTPYKITVIAV
YEDGDGGHLIGNGRTVGLLPPQNIHISDEWYTRFRVSWDPSPSPVLGYKIVYKPVGSNEP
MEAFVGEMTSYTLHNLNPSTTYDVNVYAQYDSGLSVPLTDQGTTLYLNVTDLKTYQIGWD
TFCVRWSAHRAATSYRLKLSPADGTRGQEITVRGSETSHCFTGLSPDADYGVTVFVQTPN
LEGPGVSVKEHTTVKPTEAPTEPPTPPPPPTIPPARDVCKGAKADIVFLTDASWSIGDDN
FNKVVKFIFNTVGAFDEISPAGIQVSFVQYSDEVKSEFKLNTYNDKAQALGALQNIRYRG
GNTRTGKALTFIKEKVLTWESGMRKNVPKVLVVVTDGRSQDEVKKAALVIQQSGFSVFVV
GVADVDYNELANIASKPSERHVFIVDDFESFEKIEDNLITFVCETATSSCPLIYLDGYTS
PGFKMLEAYNLTEKNFASVPGVSLESGSFPSYSAYKLQKNAFVNQPTADLHPNGLPSSYT
IILLFRLLPETPTDPFAIWQITDRDYKPQVGVIADPSSKTLSFFNKDIRGEVQTVTFDTD
EVKTLFYGSFHKVHVVVTSKSVKIYIDCYEIIEKDIKEAGNITTDGYEILGKLLKGERKS
ATFQIQSFDIVCSPVWTSRDRCCDIPSRRDEAKCPALPNACTCTQDSVGPPGPPGPAGGP
GAKGPRGERGISGAVGPPGPRGDTGPPGPQGPPGPQGPNGLSIPGEQGRQGMKGDAGEPG
LPGRTGTPGLPGPPGPMGPPGDRGFTGKDGAMGPRGPPGPPGSPGSPGVTGPSGKPGKPG
DHGRPGPSGLKGEKGDRGDIASQNMMRAVARQVCEQLISGQMSRFNQMLNQIPNDYHSSR
NQPGPPGPPGPPGSAGARGEPGPGGRPGFPGTPGMQGPPGERGLPGEKGERGIGSPGPRG
LPGPPGPQGESRTGPPGSTGSRGPPGPPGRPGNSGIRGPPGPPGYCDSSQCASIPYNGQG
YPEPYVPEGGAYLPEREPFIVPVEPERTPDEYEDYGADEPGDEHPPHARWRRALPRGPGQ
RT
NT seq 9369 nt   +upstreamnt  +downstreamnt
atgcggaccgggcttcccccagcgcttgccgccctgggcgcggccctgctcctgtcttcc
atcgaggcagaagttgacccaccttcagacttgaattttaaaataatagatgaaaatact
gttcatatgtcatgggcaagaccagctgatccaattgtgggttacagaataacagtggac
cctacaacagatgggcccactaaagaatttacccttgcagctagtaccactgaaacttta
ttatcagaccttatacctgaaatagagtatgtggtaacaatcacttcatatgatgaagta
gaagagagtgttccagttataggacaattaacaattcaaacaggtggtcccacaaagcca
ggggagaagaaacctggaaaaccagagatacaaaaatgctctgtcagtgcctggactgat
ctagtgtttctcgtggatggctcatggagtgtgggaagaaataattttaagtatatttta
gactttattggtgctcttgtgtctgcttttgacattggagaagaaaagacaagggttgga
gttgttcagtacagctctgataccaggaccgaatttaacttaaatcagtactaccgaaca
gatgagcttcttgctgcaattaaaaaaattccatacaaaggtggcaacacaatgacgggg
gatgccattgattacttaattaaaaatactttcacggaatctgctggagcaagagttggc
tttcctaaagtggcaattattattactgatggcaaatcccaggatgaagtggaaattcca
gcaagagagcttcgaaatataggggttgaagttttctctttgggcattaaagctgcagat
gcaaaagaactcaaacaaattgcctccacaccttcattaaaccatgtcttcaatgtggcc
aactttgatgcaattgtggatattcagaatgagataatctcccaggtgtgctccggtgta
gatgaacaactgggtgaattggttagtggagaagaagttattgaacctccttcaaatttg
gttgctacggaagtctcatcaaaatatattaagctaagttggagtccatctcctagctca
gtaactggttataaagtcctccttacaccaatgaccgctggaagccgacagcatgctctt
agtgtggggcctcagaccaccacactcagtgttcgtgacctctcagcagacacagaatac
cagatcagtatttctgctatgaagggactcacatccagtgaacctgtttcaataatggag
aagactcagcccatgaaagttcaagtggaatgctcacgtggtgtggatataaaagccgat
attgtgtttttggttgatggttcctatagcatcgggattgcaaactttgttaaagttaga
gcctttctggaagttctcgtaaaaagttttgagatttcaccaaatagggtacagataagt
cttgtccagtacagccgggatcctcatactgagttcactttgaaaaaattcaccaaagtg
gaagatataattgaagcaataaacaccttcccctacagaggaggatctacaaacactggg
aaagcaatgacttatgtcagagagaaaatatttgtgcctagcaagggttcaagaggcaac
gtaccaaaggtcatgattcttatcactgacgggaaatcttcagatgctttcagagatcct
gctataaaactaaggaattcagatgtggaaatctttgcagttggtgtgaaggatgctgtt
cgctcagagttagaagctattgcctctcctcctgctgagacccatgtgttcacagtggaa
gattttgatgcttttcagagaatatcttttgaactcacacagtctatctgccttagaatt
gagcaagaattggcagctataaagaaaaaagcttatgtgcctccaaaggatcttagtttt
tctgagacaacttcttacagtttcaaagctaactggtctcctgctggagaaaatgttttc
tcataccacatcacctacaaggaagctactggagatgatgaggtcacggtggtagagcca
gcgtcaagtaccagtgttgttctcaacaacctgaagccagagaccctgtacttagttaat
gtgactgcagagtatgaggatggcttcagtgttcccttaactggagaggagaccactgtg
gaagtaaaaggagcacctcgaaacctaaaagtgacagatgaaactacagacagctttaaa
atcacctggactcaagctccagggagagttttaaggtaccgaattatatataaaccagtt
gctagtggagaaagcaaagaagttaccacccctgccaatcagaggaggataacgctcgag
aacctgactccagacacaaaatatgaagtatctgtaattcctgaatatttctcaggacct
ggctccccgttgactggaaatgcagccactgaagaagttagagggaccccaagagactta
agagtttctgaccctacaacatcaactatgaaattatcttggactcgagcaccagggaaa
gtgaaacagtatctcgtcacatacatcccagcggcagggggtgaaactcaagaggtcact
gtgagaggagatacaaccagtactgtgctgagaggattaaatgaagggacacaatacgcc
ttatctgtgacggccttgtatgcatccggggctggagatgccctttatggcgaaggaatg
accctcgaagaacgtggttcacccaaggatttggttactaaagatatcacagacacatca
attggggcttattggacatcagctccaggaatggttcgaggttacagggtctcatggaaa
tcactttatgatgatattgagactggagagaaaagtcttcccggagatgcaattcatacc
gtgatagaaaatcttcagccagagaccaaatataaggtttcagtctttgcagtttacagc
agtggagaaggagaacctttgaacggagaagccacaactgaattatcccaagattcaaaa
accttgaaagtggatgaagaaacagaaaacacaatgcgagttacctggaaaccagcaccc
gggaaagtcatcaactaccgggttgtgtatcgcccccgtgggggtgggagacaaatggtg
gccaaagtgccacccacagtcacctcaacagtgttaaagcgacttcaaccccagactaca
tatgacattacagttctcccaatgtataagacaggagaaggaaagcttaggcaaggatcg
ggaacaacagcttctcgatttaagtcacccagaaatctcaaaacatctgacccaaccatg
tcaagtttccgagtgacctgggagcctgcccctggggaagtaaagggttataaagtcacc
ttccaccctacaggggacgacagaaggctgggggagttagtggttggaccatatgacaat
acagttgttttggaggaacttagggcaggtaccacctataaagtaaatgtttttggaatg
tttgatggaggagaaagttcgccactcgttggacaagaaatgacaaccctttctgacaca
actgtaatgccaattttatcctctgggatggagtgtctcaccagagcagaagcagatatt
gtgttgctggtggatggatcatggagcattggccgggcgaactttaggaccgtgaggagt
ttcatctctcgcattgtggaagtctttgagattggtcccaaaagagtacagattgccctt
gctcagtatagtggggaccccagaacagagtggcagctaaatgctcacagagacaagaag
agcttgttgcaagctgtggcaaacttgccatacaaaggaggcaatactctcacaggcatg
gctttgaatttcattcggcaacaaaacttcagaacccaagctggcatgaggcctcgagct
cgaaaaattggtgttctcatcactgatggaaaatcacaagatgacgttgaggcaccttca
aagaaactcaaggatgaaggcgtggagctgtttgctattggtattaaaaatgctgatgag
gatgaattaaagatgattgcaacagatcctgatgatacccatgcatacaacgtggcagat
tttgagtcactctctaagattgtagatgacctcactattaacttatgtaatagtgtcaaa
ggtccaggtgacttggaagcaccttccaacttagttatttctgaacgaacccatcgttct
ctcagagtgagctggacacctccttctgacagtgtggataggtataaggtggaatactac
ccagtttctggagggaaacgtcaagaattttatgtgagccgactggaaagtagtacagta
ctgaaagatctgaagcctgaaactgagtatgttgttaatgtgtattctgtggtggaagat
gaatatagtgaacctctgaagggcacagaaaaaaccttaccggtccctgtggtcagcatg
aatatttatgatattagccctaccaccatgcatgtgcagtggcagccggtgggaggagct
actggctataccttgtcctatgaacccatcaatggcacagaaccaacaaagcccaaagag
atgcgtgtggggccgacagtgaatgacgtgcagctgactgatctttcccccaacacggaa
tatgcagtcacagtccaggctgctttgcatgacctcaccagtgaacctgtcacggctcgg
gaagttacattgcctttacccaaacctcgagatctgagactcagagatgtgactcacagt
accatgaacgttttatgggaacctgcacctggaaaagtgcgtaaatacatcgttcgctac
aaaacaccagaagaggatgtcaaagaggtggaggtagacaggtcgcggaccagcacccct
ctcagagacctcttctcacaaaccctgtacacagtagacgtttctgccatatatgatgag
ggggagtctcccccagtgactgctcaagaaactacccgcactgtgccagccccaacaaac
ctgaagataactgaagtaacaccagagagtttccgagggacttgggatcatggagcttca
gatgtgtccctctacagaataacttgggcaccatttggaagctcagataagatggagacc
atcttaaatggagatgaaaatactttggtgtttgaaaacctgaacccgaacacactctat
gaagtttctgttactgccatttatcctgatgagtcagaaagcgatgacctgactggcagt
gagcgcacacctcgtttgatacccttaacaacacaagctccaaaaagtggcccacgaaac
cttcaggtgtacaacgcaacttctaacagcttgactgttaagtgggatcccgccagtggt
cgtgtgcagaaatacagaatcacttaccagccttcaacaggagaaggcaatgagcaaacg
accacaatagggggaaggcagaacagtgttgtcctacagaaactgaagcccgacacccct
tacacgatcactgtgtcctccctgtatcctgatggtgaaggaggtcggatgacaggaaga
ggcaagaccaaacctctgaatactgtgaggaacctcagagtgtatgacccttctaccagc
accttgaatgttcgctgggaccatgcagagggaaaccctcgtcagtacaagctcttctat
gcaccaacagcaggtggtccagaggaactggtaccaatccctgggaataccaattatgcc
attcttaggaatctgcagccagataccccgtacaccgttacagtagttcctgtttatact
gaaggtgatggaggacgcacatcagatactggaaggacattggtgagagggctggcaagg
aatgtccaagtgtacaatccgacgccaaatagcctagatgtccgctgggaccctgcgcct
gggcctgtgcagcagtatcggatcgtgtattctcctgtggctggcacaagaccttcggaa
tctattgtggtgccaggaaacacgcgcacagtgcacctggagcggctgattcccgacaca
ccctactctgtgaacatcgtagctctctactcggatggagaggggaatcccagccctggc
cagggccgaacgctgccacgaagtggaccaagaaatataagagtctttggggaaacaacc
aacagcctctctgtagcctgggatcatgctgatgggccggttcagcaatacaggatcatt
tattctcccactgttggcgatccaattgatgaatataccacggtcccaggcagaaggaat
aatgtgatgctgcagcccctgcaacctgatactccatataagattactgttattgctgtt
tatgaagatggagatggaggccatcttatagggaatggaagaaccgtgggactgcttcca
cctcaaaacatacacatctctgatgaatggtatacaagattcagggtatcctgggatcct
tcaccttctccggttcttggatataaaattgtgtataagccagtgggttccaatgagccc
atggaagcttttgttggagaaatgacatcatatacattacacaatctcaatcctagcacc
acctatgatgtaaatgtttatgctcagtatgattctggactcagtgtccccctgacggat
caaggcactacattgtatttaaatgtgacagatctgaaaacctaccagattgggtgggat
acattctgtgttagatggtcagctcaccgggcagccacctcctacaggctaaaactaagc
cccgcagatggaaccagaggacaagaaattacagtgcgtggatcagaaaccagtcactgc
ttcactggtctttcaccagacgctgattatggcgtcaccgtttttgtgcagacaccaaat
ctcgagggaccaggagtctctgtcaaggaacataccactgtaaaaccaacagaagcccct
acggagccacccacacctcctccccctcctacaatcccaccagcccgggatgtatgcaaa
ggggccaaggcagatattgtattcttgactgatgcctcctggagtatcggggatgataat
tttaacaaagttgtaaaattcatcttcaatactgtgggagcctttgatgaaattagccct
gctggaattcaggtctcgtttgtgcagtacagtgatgaggtcaagtctgagttcaagttg
aacacatataacgacaaggcccaagccctgggggccctccagaatattagatacagagga
ggaaacacaagaacaggcaaggctctcacatttatcaaggagaaggtcttgacctgggag
agcggcatgaggaagaatgtccccaaggtgctggttgtggtcacagatggccggtcacag
gatgaggtcaagaaggcagctttggtcatccagcagtcagggttcagtgtctttgtagtt
ggagtggctgacgttgactacaatgagcttgccaatattgccagcaaaccaagcgaacgg
cacgtgttcattgttgatgactttgaatcttttgagaagattgaggacaacctcattaca
tttgtctgtgaaactgctacttcaagttgtcctctcatttatttggatggctacacctca
ccaggttttaagatgcttgaagcatacaacctgacagaaaagaattttgcttctgtacca
ggagtctctttggagtcagggtctttccccagctactcagcttacaagcttcagaagaat
gcttttgtgaaccagcctacagcggatctacatccaaatggactcccttcttcatacacg
attatattattgttcagacttctcccagaaactcccactgacccttttgcaatttggcaa
atcacagatagggactacaaaccacaagttggagtgattgcagatccttctagcaagaca
ttgtcattctttaacaaggatataagaggtgaggtgcaaactgttacatttgacacagat
gaagtgaagacattattctatggaagttttcacaaggttcatgtcgtagtgacctcaaaa
agtgttaagatttacatcgactgctatgaaattatagaaaaagatatcaaggaagctgga
aatattacaactgatggttatgaaattcttggaaaacttcttaaaggggaaagaaaatca
gccacattccaaatccagagtttcgatattgtttgcagtccggtgtggaccagtagagac
agatgctgtgatattccctctaggagagatgaagcaaaatgccctgctcttccaaatgct
tgcacatgtacacaggacagcgttggacctccaggtccaccgggccctgcgggaggacct
ggtgctaaaggtcccagaggtgaaagaggaatcagcggggcagttgggcctcctggccct
cgtggagatacaggtcctccaggccctcagggacccccaggcccccagggacccaacgga
ctctctattcctggagaacaaggtcgccaggggatgaaaggtgatgctggagagccaggg
cttcccggccgaacaggaaccccaggattacctggcccaccaggaccaatgggacctcca
ggagatagaggctttactggaaaagatggtgcaatgggacccaggggcccccctgggcca
ccgggaagcccaggctccccaggagtcacaggaccaagtgggaaaccaggaaaacccgga
gaccatggcagaccaggtccatctggattgaaaggagagaaaggcgatagaggagacatt
gcttcccagaacatgatgcgagcagttgcaagacaagtctgtgaacaattgataagtggt
cagatgagcagattcaatcagatgctgaatcagattccgaatgattatcactccagtcgc
aaccaaccaggcccaccaggccccccaggcccccctggcagcgcaggagccagaggagaa
ccaggacctggggggcgaccaggcttccccggcactccagggatgcagggacccccaggt
gaacgaggtttgccaggagagaaaggcgaaaggggtattgggtcaccaggacctcgaggg
ctgcctggccccccaggtcctcaaggagaatccagaacgggtccaccagggtccacaggt
tcaagaggtccccctggccccccgggtcgtcctggaaactcaggtatccgaggcccccca
ggtcctcctggatactgtgactcatcccagtgtgccagcatcccatacaatgggcaaggc
tatccagagccgtacgtgcccgagggcggggcctacctgcccgagcgcgagcccttcatc
gtgccggtggagcccgagcggacgcccgacgagtacgaggactacggcgccgacgagcct
ggcgacgagcaccctccccacgcgcgctggcggcgcgccctgccccgcggccccgggcag
cgaacctga

DBGET integrated database retrieval system