KEGG   Canis familiaris (dog): 481932Help
Entry
481932            CDS       T01007                                 

Gene name
FBXL4
Definition
(RefSeq) F-box/LRR-repeat protein 4
  KO
K10270  F-box and leucine-rich repeat protein 4
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cfa04121]
    481932 (FBXL4)
   03029 Mitochondrial biogenesis [BR:cfa03029]
    481932 (FBXL4)
Ubiquitin system [BR:cfa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     481932 (FBXL4)
Mitochondrial biogenesis [BR:cfa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    481932 (FBXL4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_4 F-box F-box-like LRR_9 F-box_4 LRR_8 Adeno_E3_CR2
Motif
Other DBs
NCBI-GeneID: 481932
NCBI-ProteinID: XP_868129
Ensembl: ENSCAFG00000003467
VGNC: 40760
UniProt: E2R1T6
Position
12
AA seq 621 aa AA seqDB search
MSPVFPMLTVLTMFYYICLRRRARTAARGEMMNSHRTIESNSRTSPLNAEVVQYAKEVVD
FSSHYGSENSMSYTMWNLAGVPNVFPSSGDFTQTAVFRTYGTWWDQCPSASLPFKRTPPN
FQSQDYVELTFEQQVYPTAVHVLETYHPGAVIRILACSANPYSPIPPAEVRWEILWSETP
TKVNASQARQFKPCIKQINFPTNLIRLEVNSSLLDYYTELDAVVLHGTKDKPVLSLQTSL
IDMNDLEDDDYEEKDGCGMDSLSQKFSSTALREGPNNGYFDKLPYELIQLILNHLTLPDL
CRLAQTCKLLNQHCCDPLQYIHLNLQPYWAKLNDTSLEFLQARCTLVQWLNLSWTGNRGF
ISVAGFSRFLKVCGSELVRLELSCSHFLNETCLEIISEMCPNLQDLNLSSCDKLPPQAFN
HIAKLCGLKRLVLYRTKVEQTALLSILNFCSELQHLSLGSCVMIEDYDVIASMIGAKCKK
LRTLDLWRCKNITENGIAELASGCPLLEELDLGWCPTLQSSTGCFAKLARQLPNLQKLFL
TANRSVCDTDIEELACNCTRLRQLDILGTRMVSPASLRKLLESCKDLSLLDVSFCSQIDN
RAVLELNVSFPKVFIKKSFTQ
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccagtctttcccatgttaacagttctgactatgttttattatatatgccttcgg
cgccgagccaggacagctgcaagaggagaaatgatgaacagccatagaactatagaatca
aacagccggacttcccctctcaacgcagaggtggtccagtatgccaaagaagtagtggat
ttcagttcccattatggaagtgagaatagtatgtcctataccatgtggaatttggcaggt
gtaccaaatgtatttccaagttctggtgacttcactcagacagctgtatttcgaacttac
ggaacatggtgggatcagtgtcctagtgcttccttgccgttcaagaggacaccgcctaat
tttcaaagccaagactacgtggaacttacttttgaacaacaggtgtatccaacagccgtt
catgttctggaaacttatcatcctggagcagtcattagaattctggcttgttctgcaaat
ccctattccccaattccacctgctgaagtaagatgggagattctttggtcagagacaccg
acgaaggtgaatgcttcccaggctcgccaatttaaaccttgtattaagcagataaatttt
cccacaaacctcatacggctggaagtaaatagttctcttctggattattacactgaatta
gatgcagtcgtgttacatggtacgaaggacaagccagtgctttctctccagacttcactt
attgacatgaatgatctagaagatgatgactatgaagaaaaggatggttgtggcatggac
agtcttagccaaaagtttagcagtactgccctcagggaagggccaaataatggatatttt
gataaactgccttatgagctcattcaactgattctgaatcatcttacgctaccagacttg
tgtcgattagcacagacttgcaaactactgaaccagcattgctgtgatcctctccaatac
atccacctcaatctgcaaccgtactgggcaaaactgaatgacacctctctggaatttctg
caggctcgctgcaccctcgttcagtggcttaatttatcttggactggcaataggggcttc
atctctgttgcaggatttagcaggtttctgaaggtttgtggatctgaattagtgcgcctt
gaattatcctgcagccactttcttaatgaaacttgcttggagattatttctgagatgtgt
ccaaatttacaggacttaaatctctcatcctgtgataaactaccacctcaagctttcaac
cacattgccaaattatgcggtcttaaacgacttgttctctacagaacaaaagtagagcaa
acagcgctgcttagcattttgaacttctgttcagagcttcagcacctcagtttgggcagt
tgtgtaatgattgaagactatgatgtgatagccagcatgataggagccaagtgtaaaaaa
ctccgaactctggatctgtggagatgtaagaatattactgagaatgggatagcagaactg
gcttctgggtgtccgcttctggaggaactcgaccttggctggtgccccactctgcagagc
agcaccggatgtttcgccaaactggcacgccagctcccaaacttgcaaaaactctttctt
acagctaacaggtctgtgtgtgacacagacattgaagaactagcgtgtaattgtaccaga
ttacggcaactggacatactaggaacaagaatggtaagtccagcatccttaagaaaactt
ctggaatcttgtaaagatctttccttgcttgatgtgtccttctgttcacagattgataat
agagctgtgctggaactcaatgtgagctttccaaaagtgttcataaaaaagagctttacg
cagtga

DBGET integrated database retrieval system