KEGG   Canis familiaris (dog): 481947Help
Entry
481947            CDS       T01007                                 

Gene name
PRDM1
Definition
(RefSeq) PR domain zinc finger protein 1 isoform X1
Organism
cfa  Canis familiaris (dog)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 SET zf-C2H2_4 zf-C2H2_6 zf-met zf-C2H2_jaz
Motif
Other DBs
NCBI-GeneID: 481947
NCBI-ProteinID: XP_005627729
Ensembl: ENSCAFG00000003694
VGNC: 44944
UniProt: F1PFR8
Position
12
AA seq 822 aa AA seqDB search
MRDLCSETRAGTPSAAPKCSSSAVRSPRLSDGTMKMDMEDADMTLWTEAEFEEKCTYIVN
DHPWDCGADGGASVQAEASLPRNLLFKYGPSSKEVIGVVSKEYIPKGTRFGPLIGEIYTN
DTVPKNANRIYFWRIYSRGELLHFIDGFNEEKSNWMRYVNPARSAREQNLAACQNGMNIY
FYTIKPIPANQELLVWYCRDFAERLHYPYPGELTMMSLTQTQSHPKQPGAEKNDLCPKNA
PKREYSVKEILKLDSHPPRGKDCYRSNISPFAAERDADDLGKNGSPEMPFYPRAVYPSRV
PLPEDFLKAYGMERPTYIARSPLPSSTTPSPSARSSPDQSLQSCSPHSSPGDTVSPLAPC
GPDHRDSYAYLNAPYGPEGLGAYPGFAPGPPLPPAFLPSYNAHYPKFLLPPYGVGCPGLG
GVGGVGGLSLFPRLYPVYGGLLGGGGGGGGGGGGLPHPLLGPASLPGSLPSDAARRPLQP
DHARQVLIPAPHSAFSLPAAAASMKDRASSPASGSPTAGTAASAEHVVQPHATSAALAAP
GGDEAVNLMKSKRNMTGYKTLPYPLKKQNGKIKYECNVCAKTFGQLSNLKVHLRVHSGER
PFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQC
KVCPAKFTQFVHLKLHKRLHTRERPHKCAHCHKSYIHLCSLKVHLKGNCPVAPATGMPLE
DLTRINEEIEKFDISDNADRLEDMEDIDVTSVVEKEILAVVRKEKEETGLKVSLQRNMGN
GLLSGCSLYESSDPSLMKLAHSNPLPLGPVKVKQETVEPMDP
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgcgggacctctgctccgagacgcgcgcggggacgccctcggctgccccgaagtgtagc
tccagtgctgtgaggtctccccggttgagcgacgggaccatgaaaatggacatggaggac
gcagacatgactctgtggacagaggccgagttcgaggagaagtgtacctacattgtgaac
gaccacccctgggactgcggcgccgacggaggggcctcggtgcaggcagaggcatccctc
cccaggaacctgctcttcaaatatggcccgagcagcaaagaggttattggagtagtgagt
aaagaatacataccaaagggaacacgttttggacccctaataggtgaaatctacaccaat
gatactgttcccaagaatgccaacaggatatacttttggcggatctattccagaggggag
cttctccacttcatcgatggctttaatgaggagaaaagcaactggatgcgctatgtgaat
ccggcgcgctctgcccgggagcaaaacctggctgcgtgtcagaacgggatgaacatctac
ttctacaccattaagcccatccctgccaaccaggagcttcttgtgtggtattgtcgggac
tttgcagagaggcttcactacccttatcccggagagctgacaatgatgagtctcacgcaa
acccagagccatccgaagcagcccggcgccgagaagaatgacctgtgccccaagaacgcc
ccaaagagggagtacagcgtcaaagagatcctgaagttggactcgcacccccccaggggg
aaggactgctaccgctccaacatttcacccttcgccgccgagagggacgccgacgacctc
ggaaaaaacgggagccccgagatgcccttctacccccgggccgtgtacccgagtcgggtc
cctctgcccgaggactttctgaaagcctacgggatggagaggcccacctacatcgcccgc
tcgcccctgccgtcctccaccaccccgagcccctcggcgagaagcagccccgaccagagc
ctccagagctgcagcccgcacagcagccccggcgacaccgtgtcgcccctggcgccctgc
ggccccgaccaccgggactcgtacgcctacttgaacgccccctacgggcccgagggcctg
ggcgcctacccggggttcgcgccgggcccgcccctgccgcccgccttcctcccgtcctac
aacgcccactaccccaagttcctcctgcccccctacggcgtcggctgccccggcctgggc
ggcgtgggcggcgtgggcggcctgagcctcttcccgcggctgtacccggtgtacggcggc
ctcctgggcggcggcggcggcggcggcggcggcggcggcggcctcccgcaccccctgctc
ggcccggcctcgctgcccggctcgctgccctcggacgcggcgcgcaggccgctgcagccc
gaccacgcgcgccaggtgctcatccccgcgccgcacagtgccttctccctgcccgccgcg
gccgccagcatgaaggaccgggccagcagccccgccagcggctcgcccaccgccggcacg
gccgcctcggcggagcacgtggtgcagccccacgctacctcagcggcgctggcggccccc
ggcggcgacgaagccgtgaatctcatgaaaagcaaaagaaacatgaccggctacaagacc
ctgccctaccccctcaagaagcagaacggcaagatcaagtacgagtgcaacgtgtgcgcc
aagacgttcgggcagctctccaacctcaaggtccaccttagagtgcacagcggagagcgg
cctttcaaatgccagacttgcaacaagggcttcactcagctcgcccacctgcagaaacac
tacctggtacacacgggagagaagccacatgaatgccaggtttgccacaagcgatttagc
agcaccagcaatctcaagacccacctgcgactccactctggagagaaaccttaccagtgc
aaggtgtgccctgccaagttcacccagtttgtgcacctgaaactccacaagcgcctacac
acccgggagcggccccacaagtgtgcccattgccacaagagctacatccatctctgcagc
ctcaaggtccacctgaaggggaactgtcctgtggccccagccacagggatgcccttggag
gatctgacccggatcaacgaagaaatcgagaagtttgacatcagtgacaatgccgaccgg
ctggaggacatggaggacatcgacgtgacctctgtggtggagaaggaaattctggctgtg
gtcagaaaagagaaagaagaaactggcctgaaagtgtctttgcaaagaaacatggggaat
ggactcctctcagggtgtagcctttatgagtcatcagacccatccctcatgaagttggct
cacagcaacccactacctctggggcctgtaaaggtcaaacaggaaacagttgaaccaatg
gatccttaa

DBGET integrated database retrieval system