KEGG   Canis familiaris (dog): 482093Help
Entry
482093            CDS       T01007                                 

Gene name
DGAT1
Definition
(RefSeq) diacylglycerol O-acyltransferase 1 isoform X1
  KO
K11155  diacylglycerol O-acyltransferase 1 [EC:2.3.1.20 2.3.1.75 2.3.1.76]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00561  Glycerolipid metabolism
cfa00830  Retinol metabolism
cfa01100  Metabolic pathways
cfa04975  Fat digestion and absorption
Module
cfa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    482093 (DGAT1)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    482093 (DGAT1)
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    482093 (DGAT1)
Enzymes [BR:cfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.20  diacylglycerol O-acyltransferase
     482093 (DGAT1)
    2.3.1.75  long-chain-alcohol O-fatty-acyltransferase
     482093 (DGAT1)
    2.3.1.76  retinol O-fatty-acyltransferase
     482093 (DGAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MBOAT
Motif
Other DBs
NCBI-GeneID: 482093
NCBI-ProteinID: XP_022282585
Ensembl: ENSCAFG00000024926
VGNC: 39912
Position
13
AA seq 492 aa AA seqDB search
MRTACEAAAASRVTENQVGRYELRGLESLETCRQTRSSQSKLCEPWQETGLPRLHQGGRP
RSLSCKRCHRLQDSLFSSDSGFNNYRGILNWCVVMLILSNARLFLENLIKYGILVDPIQV
VSLFLKDPYSWPALCLVIVANVFAVAAFQVEKRLAVGALTEQAGLLLHVLNLATILCFPA
AVALLLESITPVGSVLALMVYTILFLKLFSYRDVNLWCRERRARAKAKAAPAGKKANGGT
AQRMVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRLLEMLFLTQLQVGLI
QQWMVPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWFFHSCMNAVAELMQFG
DREFYRDWWNSESVTYFWQNWNIPVHKWCLRHFYKPMLRRGSSKWVARTGVFFASAFFHE
YLVSIPLHMFRLWAFTGMMAQIPLAWIVSRFFQGNYGNAAVWLTLIIGQPVAVLMYVHDY
YVLHYEAPVVGA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgcgcactgcatgcgaagctgccgccgcctctagagttactgagaatcaggtaggcagg
tatgagctgaggggcctagagtctttggagacatgccgtcaaaccaggtcatcccagagc
aagctgtgtgaaccctggcaggagacaggtctgcccagacttcatcaaggtggacggccc
aggagcctgagctgcaagaggtgccaccgcctgcaagattctttgttcagctctgacagt
ggctttaacaactaccgtgggatcctgaattggtgtgtggtgatgctgatcttgagcaat
gcacggttatttttagaaaacctcatcaagtacggcatcctggtggatcccatccaggtg
gtgtctctgtttctgaaggacccctacagctggcccgccttgtgtctggttattgtggcc
aatgtctttgctgtggctgcgttccaggtggagaagcgcctggcggtgggtgccctgacg
gagcaggctgggctgctgctgcacgtgctcaacctggccaccatcctctgcttcccggca
gccgtggccttgctgctcgagtccatcacgccagtgggctccgtgctggctctgatggtg
tacaccatcctcttcctcaagctcttctcctaccgggacgtcaacctgtggtgccgagag
cggagggcacgggccaaggccaaggctgctcccgcaggtaagaaggccaacgggggaact
gcccagcgcatggtgagctacccggacaacctgacctaccgagacctgtactacttcctg
tttgcccctactctgtgctatgagctcaactttccccgctctccccgcatccgaaagcgc
ttcctgctgcggaggctccttgagatgctgtttttgactcagctgcaggtggggttgatc
cagcagtggatggtccccaccatccagaactccatgaagcctttcaaggatatggattac
tcccgcatcatcgagcgcctcctgaagctggcggtccccaatcacctaatctggctcatc
ttcttctactggttcttccactcgtgcatgaacgccgtggccgagctcatgcagttcgga
gaccgggaattctaccgggactggtggaactcggagtctgtcacctacttctggcagaac
tggaacatcccggtgcacaagtggtgcctcaggcacttctacaagcccatgctccgacgg
ggcagcagcaagtgggtggccaggactggggtattcttcgcctccgccttcttccacgag
tacctggtgagcatcccgctgcacatgttccgcctctgggccttcacgggcatgatggct
cagatcccactggcctggatagtgagccgcttcttccagggcaactatggcaacgcagct
gtgtggctgacactcatcatcgggcagccggtggccgtgctcatgtacgtccacgactac
tatgtgctccactatgaggctcctgtggtgggggcctga

DBGET integrated database retrieval system