KEGG   Canis lupus familiaris (dog): 482154
Entry
482154            CDS       T01007                                 

Gene name
KDR
Definition
(RefSeq) vascular endothelial growth factor receptor 2 precursor
  KO
K05098  kinase insert domain protein receptor [EC:2.7.10.1]
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa01521  EGFR tyrosine kinase inhibitor resistance
cfa04010  MAPK signaling pathway
cfa04014  Ras signaling pathway
cfa04015  Rap1 signaling pathway
cfa04151  PI3K-Akt signaling pathway
cfa04370  VEGF signaling pathway
cfa04510  Focal adhesion
cfa05205  Proteoglycans in cancer
cfa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    482154 (KDR)
   04014 Ras signaling pathway
    482154 (KDR)
   04015 Rap1 signaling pathway
    482154 (KDR)
   04370 VEGF signaling pathway
    482154 (KDR)
   04151 PI3K-Akt signaling pathway
    482154 (KDR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    482154 (KDR)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    482154 (KDR)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    482154 (KDR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    482154 (KDR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfa01001]
    482154 (KDR)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cfa04090]
    482154 (KDR)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     482154 (KDR)
Protein kinases [BR:cfa01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   482154 (KDR)
CD molecules [BR:cfa04090]
 Proteins
  482154 (KDR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 I-set Pkinase Ig_2 ig V-set VEGFR-2_TMD C2-set_2 Ig_4
Other DBs
NCBI-GeneID: 482154
NCBI-ProteinID: NP_001041489
Ensembl: ENSCAFG00000002079
VGNC: 42331
UniProt: Q2XPT7
Position
13
AA seq 1355 aa
MESKALLAIALWLCVETGAASGGLPSVSLHPPRLSIQKDILTIMANTTLQITCRGQRDLD
WLWPNNQSGSEKRVEVTECSDSFFCKMLTIPKVMGNDTGAYKCFYRDTDMASVIYVYVQD
YRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWD
SKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYKIYDVILSPPHGVELSVGE
RLVLNCTVRTELNVGLDFNWEYPSLKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRS
DQGWYTCAASSGLMTKRNSTFIRVHEKPFVAFGSGMESSVEATVGDRVRIPVKYLGYPPP
EIKWYKNGRPIESNHTIKVGHVLTIMEVSEKDTGNYTVILTNPISKEKQSHVISLVVNVP
PQIGEKSLISPVDSYQYGTTQSLTCTVYAVPPPHHIRWYWQLEECAYKPAQAVLMTNPYT
CKEWRNVDDFQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAVNKVGRGER
VISFHVIRGPEITLQPDTQPTEQESVSLWCTADRTTFENLTWYKSGPQALAVHAGEVPTP
VCKNLDALWRMNATTFSNGTSDILILELQNVSLQDQGDYVCFAQDRKTKKRHCVVRQLTV
LERVAPMITGNLENQTTSIGETIEVSCTTSGNPPPQITWFKDNETLVEDSGIILKDGNRN
LTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIVEGAQEKTNLEVIILVGTAVIAMFFWLL
LVIVLRTVKRANGGELKTGYLSIVMDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPLG
RGAFGQVIEADAFGIDKTATCKTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNL
LGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKTKGARFRQGKEYVGEITMDPKR
RLDSITSSQSSASSGFVEEKSLSDVEEEEVSEDLYKNFLTLEHLICYSFQVAKGMEFLAS
RKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRV
YTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLD
CWHGEPNQRPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVSC
MEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDSG
MVLASEELKTLEDRTKLAPSFSGLMPSKSKESVASEGSNQTSGYQSGYHSDDTDTTVYSS
EEAELLKLMEIGPQAGSAAQILQPDSGPTLSSPPV
NT seq 4068 nt   +upstreamnt  +downstreamnt
atggagagcaaggcgctgctggccatcgctctgtggctctgcgtggagaccggggctgcc
tccgggggtttgcctagtgtttcccttcatccacccagactcagcatacaaaaagacata
cttacaattatggctaatacaactctccagattacttgcaggggacagagggacttggac
tggctctggcccaacaatcagagtggctctgagaaaagagtggaggtgactgagtgcagt
gacagcttcttttgtaagatgctcacgattccaaaagtgatgggaaatgatactggagcc
tacaagtgcttctatcgggacactgacatggcctcggtcatttatgtctacgttcaagat
tacaggtctccatttattgcttctgttagcgaccaacatggagtcgtgtacatcactgag
aacaaaaataaaactgtggtgattccatgtcttgggtccatttccaacctcaatgtgtca
ctttgtgcaaggtatccagaaaagaggtttgttcctgatggaaacagaatttcctgggac
agtaagaaaggctttactatccccagctacatgatcagctatgctggcatggtcttctgc
gaagcaaaaattaatgatgaaagttaccagtctattatgtacatagttgtggttgtaggg
tacaagatttatgatgtgattctcagcccccctcacggagttgagctgtctgttggagag
aggcttgtcttaaattgtactgtaagaactgaactaaacgtagggcttgacttcaactgg
gaatacccttctttgaagcatcagcataaaaaacttgttaaccgggacctaaaaacccag
tctgggagtgagatgaagaaatttttgagcaccttgactatagatggtgtaacccggagt
gaccaagggtggtacacctgtgcagcttccagtgggctgatgaccaagaggaacagcaca
ttcatcagggtccacgaaaaaccctttgttgcttttggtagtggcatggaatcttcggtg
gaagccactgtgggagatcgtgtcagaatccctgtgaagtaccttggttaccctccccct
gaaataaaatggtataaaaatggaagacccattgagtccaatcacacaataaaagtgggg
catgtcctgacgattatggaagtgagtgaaaaagatacaggaaattatactgtcatcctt
accaaccccatttcaaaggagaaacagagccacgtgatatctctggttgtgaatgtcccg
ccccagatcggtgagaaatccctgatctctccggtggattcctaccagtatggcaccacg
cagtcgctgacatgcacggtctacgccgtcccccctccgcaccacatccgctggtactgg
cagctggaggagtgcgcctacaagcccgcccaagctgtcttaatgacaaacccatacact
tgtaaagaatggagaaacgtggatgacttccaggggggaaataaaattgaagtcaacaag
aatcagtttgccctaattgaaggaaagaacaaaactgtaagtacccttgttatccaagca
gccaatgtgtcagctttgtacaaatgcgaagccgtcaataaagttgggagaggagagagg
gtcatctccttccacgtgatcaggggccctgaaatcactttgcaaccggacacccagcca
accgagcaggagagcgtgtctttgtggtgcactgcagacagaactacgtttgagaacctc
acgtggtacaagtctggcccacaggctctggcagtccatgcgggagaggtgcccacacct
gtttgcaagaacttggatgctctttggagaatgaatgccaccacgttctctaatggcaca
agtgacattttgatcctggagctccagaatgtgtccttgcaggaccaaggagactatgtg
tgcttcgctcaggacaggaagaccaagaaaagacattgtgtggtcagacagctcacagtt
ttagagcgcgtggcgcccatgatcaccggaaacctggagaatcagactacaagtattggt
gaaaccattgaagtttcatgcaccacatctgggaatccccctccacagattacctggttt
aaagataacgagacacttgtggaagactcaggcattatactgaaagatgggaaccggaac
ctcaccatccgtagggtgaggaaggaggatgaaggcctctacacctgccaggcatgcagt
gttcttgggtgtgcaaaagtggaggcatttttcatagtagaaggtgcccaggagaagacg
aacttggaagtcattattctagtaggcacggcagtgattgccatgttcttctggttatta
cttgtcatcgttctacggaccgttaagcgggccaatggaggggaactgaagacaggctac
ttgtccatcgtcatggatccagatgaactccccttggatgagcactgtgaacgcctgcct
tatgatgccagcaaatgggagttccccagggaccggctaaaactaggtaagcctcttggc
cgtggggcctttggccaagtgattgaagcagatgcctttggaatcgacaagacagcaact
tgcaagacagtggccgtcaaaatgttaaaagaaggagcaacacacagtgaacaccgagcc
ctcatgtctgaactcaagatcctcattcatattggccaccatctcaatgtggtcaatctc
ctgggtgcctgtaccaagccgggagggccactcatggtgattgtggaattttgcaagttt
ggaaacctgtcaacttacttaaggagcaagagaaatgaatttgtcccctacaagaccaaa
ggggcccgattccgtcaggggaaagaatacgttggggaaatcactatggatccaaagcgc
cgcttggacagcatcaccagtagtcagagttcggccagttctgggtttgttgaagaaaaa
tccctcagtgatgtggaggaagaggaagtctccgaagatctgtacaagaacttcctgacc
ttggagcatctcatctgttacagcttccaggtggccaagggcatggagtttttggcatca
cggaagtgtatccacagggacctggcggcacgaaacatcctcttgtcggagaagaacgtg
gttaagatctgtgactttggcttggcccgggatatttataaagacccagattatgtcaga
aaaggagacgctcgcctccctttgaaatggatggctccagagacgatttttgacagagtg
tacacaattcagagtgatgtgtggtcttttggtgtcttgctctgggaaatattttcctta
ggtgcttctccgtatcctggagtaaagattgatgaagaattttgtaggcgattgaaagaa
ggcaccagaatgagggcccctgattataccacaccagaaatgtaccagaccatgcttgac
tgctggcatggggaacccaatcagagacccacgttttccgagttggtggaacatttggga
aatctgctacaggctaatgctcagcaggatggcaaagactacattgttctccccatatca
gagactttgagcatggaagaggattctggactctctctgcctacctcacctgtttcctgt
atggaggaagaggaagtgtgtgaccccaaattccattatgacaacacagcaggaatcagc
cagtatctgcagaacagtaagcgaaagagccggcccgtgagtgtaaaaacatttgaagat
atcccattggaagaaccagaagtaaaagtaatcccagatgacaaccagacggacagtggt
atggtccttgcctcagaagagctgaaaaccctggaagacagaaccaaattagctccatct
tttagtggactgatgcccagcaagagcaaggagtctgtggcatccgaaggctctaaccaa
acgagtggctaccagtccggctatcactccgatgacacggataccactgtgtactccagc
gaggaggccgaacttttaaagctgatggagattggaccacaagctggcagtgcagcccag
attctccagcctgactctgggcccacattgagctctcctcctgtttaa

DBGET integrated database retrieval system