KEGG   Canis lupus familiaris (dog): 482188
Entry
482188            CDS       T01007                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa00230  Purine metabolism
cfa00240  Pyrimidine metabolism
cfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    482188 (DCK)
   00240 Pyrimidine metabolism
    482188 (DCK)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     482188 (DCK)
SSDB
Motif
Pfam: dNK AAA_18 AAA_28 Thymidylate_kin AAA_33 CoaE
Other DBs
NCBI-GeneID: 482188
NCBI-ProteinID: XP_539307
Ensembl: ENSCAFG00000002931
VGNC: 39802
UniProt: E2R607
Position
13
AA seq 260 aa
MATPPKRSCPSPATGSEGSRIKKIAIEGNIASGKTTFVNILKQVCEDWEVVPEPVARWCS
VRSAQGDCEELTTSQKSGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLACLDGKLKDAE
KPVLFFERSIYSDRYVFAANLYESECMNETEWTIYQDWHDWMNHQFGQSLELDGIIYLRA
TPEKCLNRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDFLQEIPILTLDINE
DFKDKHDGLIEKVKEFLSTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atggccaccccgcccaagagaagctgcccgtcccccgcgaccggctcggagggaagccgc
atcaagaaaatcgccatcgaggggaacatcgcttcagggaagacaacatttgtgaatatc
cttaaacaggtctgtgaggattgggaagtggttcctgaacctgttgcccgttggtgcagt
gttcgaagtgctcaaggtgactgtgaggaactgacaacatctcagaaaagtggtgggaat
gttcttcagatgatgtatgagaagcctgaacggtggtcttttaccttccagtcatatgcg
tgcctcagtcgaataagagcccagcttgcctgtcttgatggcaagctcaaagatgcagag
aaacctgtattattttttgaacgatctatatatagtgacaggtatgtctttgcagctaat
ctgtatgaatctgagtgcatgaatgaaacagagtggacaatttatcaagactggcatgac
tggatgaatcaccaatttggccaaagcctggaactggatggaatcatttatcttcgagcc
actccagagaaatgcttgaatagaatatatttacggggaagaaatgaagaacaaggcatt
cctcttgaatatttagagaagcttcactataagcatgagagctggctacttcatagaaca
ctgaaaaccaactttgattttctacaagaaatccctatcttaactctggatatcaatgaa
gactttaaagacaaacacgatggtcttattgaaaaggtcaaagaatttttgagcactttg
tga

DBGET integrated database retrieval system