KEGG   Canis familiaris (dog): 482234
Entry
482234            CDS       T01007                                 

Gene name
OR2M9
Definition
(RefSeq) olfactory receptor 2M3
  KO
K04257  olfactory receptor
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    482234 (OR2M9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cfa04030]
    482234 (OR2M9)
G protein-coupled receptors [BR:cfa04030]
 Others
  Chemoreception
   Olfactory
    482234 (OR2M9)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 482234
NCBI-ProteinID: XP_539353
Ensembl: ENSCAFG00000001253
UniProt: F1PV37
Position
14
AA seq 311 aa
MALDNQTFNSDFILLGIFNYSPTHIFLFSMLLVIFTVVFMGNTAMILLIYLDTQLHTPMY
FFLSQLSLMDLMLICTTVPKMAFNYLSGSNSISVVECATQIFLYTSLLGCERFLWAVMAY
DRYIAICYPLRYPNLMSPKICGLMAASSWILGSTDCIIDAVATFFFFYCGSREIDHFCDF
PSLLIISCNDTSTFEEVLFYCCIIMIVFPVVIIIASYTHVIVAVIHIASGEGHQKVFATC
SSHLMVVGMYYGTTLFIYMRPASDRSPTQDKMVSVFYTILTPMPNPLVYSLRNKEVARAA
MKVLEKGRSGQ
NT seq 936 nt   +upstreamnt  +downstreamnt
atggcattggacaatcagacttttaactctgatttcatccttctgggaatcttcaattac
agccccactcacatcttcctcttttctatgcttttggtcatcttcacagtggtcttcatg
ggaaacactgctatgattctcctcatctacctggacactcagctccacacacccatgtac
ttctttctcagccaactgtccctcatggacctcatgctcatctgcaccactgtacccaag
atggcttttaactatttgtctggcagcaattccatttctgtggtagagtgtgctacacaa
attttcctctatacatcactacttggctgtgaacgtttcctatgggcagtaatggcttat
gaccgctatattgccatttgctaccctctaagatatcctaatcttatgagccctaaaatt
tgtggacttatggctgcatcttcctggatcctgggctctactgattgtatcattgatgct
gtagctacatttttcttcttctattgtgggtcccgggaaatagaccacttctgtgatttt
ccttccctgctcatcatctcatgcaacgacacatcaacatttgaagaagttcttttctac
tgctgtataataatgattgttttccctgtagtgatcatcattgcttcctatactcatgtt
attgtggctgtcattcacatagcatctggagagggtcaccagaaagtttttgccacctgc
tcttctcacctcatggtggtgggaatgtattatggcacaactttgttcatatacatgcgg
cccgcttctgatcgttcccccacccaggacaagatggtctctgtcttctacaccattctc
actcccatgccgaatcccctcgtctacagcctccgcaacaaggaagtggctagagcagcc
atgaaggtgttggagaagggcaggtctggacagtaa

DBGET integrated database retrieval system