KEGG   Canis lupus familiaris (dog): 482269
Entry
482269            CDS       T01007                                 

Gene name
GCC1
Definition
(RefSeq) GRIP and coiled-coil domain-containing protein 1
  KO
K20281  GRIP and coiled-coil domain-containing protein 1
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    482269 (GCC1)
Membrane trafficking [BR:cfa04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    482269 (GCC1)
SSDB
Motif
Pfam: GRIP KASH_CCD LPP
Other DBs
NCBI-GeneID: 482269
NCBI-ProteinID: XP_539388
Ensembl: ENSCAFG00000001730
VGNC: 41139
UniProt: E2RDJ0
Position
14
AA seq 775 aa
MEKFGMNFGGGPSKKDLLETIETQKKQLLQYQARLKDVVRAYKSLLKEKEALEASIKVLS
VSHEADVGLTGVQPPGLSFPDSADDRCSTHSEDSTGTATSLDTAASLTSTKGEFGVEDDR
LARGPPPPKSEEASGSESGVSSSSGDGASGGGEVDKRLHQLKTQLATLTSSLATVTQEKS
RMEASYLADKKKMKQDLEDTSKKAEEERGRLEGELKGLQEQIAETKARLITQQHDRAQEQ
SDHAVMLRELQKLLQEERTQRQDLELRLEETREVLAGRAYAAGQMEGFELQTKQLTREVE
DLKGELQALREEKNRPDPRLQELQEEAACLKSHFQAQLQQEMRKTALAEDQLRQQSEVEE
QRVAALENQISEVSELLGTYEKAKQKDQLAIQKLKERILQLDLENKTLALAASSRSPLDS
HGEESSLDVNVLKDKMEKLKRLLQVAARKSQVTLDVEKLCDLEIMPSSEAADGEKASVLY
YQQELKQLKEEFERYKMRAQVVLKSKNTKDGNLAKELEEAQEQLAELKEKYISLRLSCEE
LERQHQQEAEDWKQELARLQHLHRQELERSQLDFRDRTLKLEEELHKQRDRALAVLAEKD
LELEQLRSAALSSGLPGRRSPVGGGGPGELADVSAPDSLTQALQLAAANEPTFFLYAEQL
ARKEVEITSLRKQKHRLEVEVHQLQDRLLEEGERHRERVGALQSHIEKNIRDQSREGANL
EYLKNIIYRFLTLPDTLGRRQTLTAILTILHFSPEEKQVIMRLPTGSSWWPSGKR
NT seq 2328 nt   +upstreamnt  +downstreamnt
atggagaagtttggcatgaatttcgggggcggaccgagcaagaaggacctgctggagacc
attgagacgcagaagaagcagctcctgcagtaccaggcacgtctcaaggatgtggtccgc
gcctataaaagtctactgaaagagaaggaggctctagaggccagcattaaggtgctgtcg
gtgtcccacgaggcggatgtgggcctcacaggcgtccagcctccaggcctctctttccct
gactctgcggatgaccgatgctccactcacagcgaagatagcactgggacagccacgagc
ttggatactgcggccagtctcaccagcaccaagggtgagtttggggtagaggatgacagg
ctggctcgtggcccaccacctccaaagtccgaagaagccagcggatcagagagtggcgtt
agcagtagcagtggagatggagcatctgggggtggagaagtggacaaacggctgcaccag
ctgaagactcagttggctactttgaccagctctttggctacagtcacccaggagaagtct
cgcatggaagcttcttacctggctgacaaaaagaagatgaaacaggacttagaggatacc
agtaaaaaggcagaggaggagaggggccgtctggagggagaattgaaggggctgcaggag
cagatagcagaaaccaaagcccgacttatcacccagcagcatgatcgggcccaagagcag
agtgaccatgctgtgatgcttcgtgagctccagaaactgctgcaggaggagaggactcag
cgccaggacttggagcttcggctggaagagacccgagaggtcctggcggggcgggcatat
gcagccggtcagatggaagggtttgaactgcagaccaagcagctgacccgtgaggtggag
gacttgaaaggtgagctacaagctcttcgagaagagaagaatcggccagaccctcggctg
caggagcttcaggaagaggccgcttgccttaagagccatttccaggctcagttgcagcag
gaaatgagaaagacagcccttgcagaagatcaactgcggcagcaatctgaggtagaagag
cagagagtggcggccctggagaatcaaatatctgaggtgtctgaattactgggcacctat
gagaaagccaagcagaaggaccagctggccatccagaagctaaaggagcgtattctgcag
ctggatctggagaacaagacactggctctggcagcctccagccggtcccctctagatagc
catggagaagagtccagtctggatgtcaatgtcctgaaggataagatggagaagctgaag
aggttgctgcaggtggcagccaggaaaagccaggtgaccctggatgtggagaagctctgt
gacctggagatcatgcccagctcagaggctgctgacggggagaaggcttccgtgctctac
taccaacaggagctgaagcagctaaaggaggagtttgagaggtacaagatgagggcccag
gtggtcctcaagagcaagaacaccaaagacggtaatctggccaaggagctggaggaggcc
caggaacagcttgcagaactgaaggagaagtatatctcattgcggctatcctgcgaggag
ctcgagcgccagcaccagcaggaggctgaggactggaagcaggagctggcccggctgcag
catctccaccggcaggagctagagcggagccagctggacttcagggaccgcacgctgaaa
ctcgaagaagagctgcacaagcagcgggatcgggccctggctgtgctggctgagaaggac
ttggagctggagcagctgcgctctgcagccttgtcctctgggctgccagggcgcagaagc
cccgtggggggcggggggcccggagagcttgccgatgtgtctgccccagatagcctgacg
caggcactgcagctggctgcagccaacgagcccacgttcttcctgtatgcggagcagctg
gcccgcaaggaggtggagatcacatcactgaggaagcagaaacacaggctggaggtggag
gtgcatcagctgcaggatcggctgctggaggagggggagcggcaccgtgagcgggtcgga
gccctacagagccacattgagaagaatatcagggaccagagcagggagggagccaacctg
gagtacctcaaaaacatcatctaccgcttcctgaccctgcccgacaccctgggccgccgg
cagacgctcacagccatcctgaccatcttgcatttcagtcccgaggagaaacaagtgatc
atgcggcttccaactggtagtagctggtggccttctggcaagagatga

DBGET integrated database retrieval system