KEGG   Canis lupus familiaris (dog): 482315
Entry
482315            CDS       T01007                                 

Symbol
COL28A1
Name
(RefSeq) collagen alpha-1(XXVIII) chain isoform X1
  KO
K23619  collagen type XXVIII alpha
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    482315 (COL28A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cfa01002]
    482315 (COL28A1)
Peptidases and inhibitors [BR:cfa01002]
 Peptidase inhibitors
  Family I2: Kunitz - BPTI family
   482315 (COL28A1)
SSDB
Motif
Pfam: Collagen VWA VWA_2 Kunitz_BPTI VWA_3 Copine
Other DBs
NCBI-GeneID: 482315
NCBI-ProteinID: XP_005628597
Ensembl: ENSCAFG00000029367
VGNC: 39470
UniProt: J9NV06
Position
14
AA seq 1143 aa
MWNRHFVFYLLLLPAFMSQTIYGQRKKGSKSNLFARKNDLQDSTCFIDVVFVVDSSESSK
IALFDKQKDFVNSLSDKVFQLTPVGFLKYDIKLAALQFSSSVQIDPPFSSWKDLQTFKQK
VKSMNFIGQGTFSYYAISNATMLLKREGRKDGVKVALLMTDGIDHPKNPDVQSISEDART
AGILFITIGLSTVVNEAKLRLISGDPPSEPILLLSDPTLADKIRDRLDILFEEKCEQKIC
ECEKGDPGDPGPPGTHGNPGIKGERGPKGNPGDAQKGEPGKRGPGGIPGYKGEKGENGEC
GKPGIKGDKGSLGPHGPKGPRGLQGISGPPGDPGPKGFQGNKGEPGPPGPDGPPGAPGIG
QQGIKGERGQEGRTGAPGPIGIGEPGQPGPRGPEGAPGERGLPGEGFPGPKGEKGSEGPI
GPQGLQGLSIKGDKGDLGPVGPQGPMGVPGIGSQGEQGIQGPMGPPGPQGPPGQGLPGSK
GEVGQTGATGPRGPVGVGVQGPKGEPGSIGLPGQPGVPGEDGAAGKKGEAGLPGTRGPEG
PPGKGQPGSKGDEGKKGSKGNHGQRGFPGPEGPKGEPGIMGPFGMPGASIPGPPGPKGDR
GGPGMPGFKGEPGIAIRGPKGAQGPRGPMGAPGLKGDGYPGVAGPRGLPGPPGPMGLRGV
GDTGAKGEPGVRGPPGPSGPRGIGTQGPKGDIGQKGLPGPPGPPGYGLQGIKGEQGPQGF
PGPKGMTGRGLPGQKGEHGEQGTVGKKGDKGEIGEPGSPGRQGLQGPKGDIGLTREEVIK
IIFEICGCGPKCKETPLELMFVIDSSESVGLENFEIIKSLVKTLSDQVALDLATARIGII
NYSHKVEKVAHLTQFSNKDDFKLAVDNMQYLGEGTYTATALHEANHMFEAARPGVKKVAL
VITDGQTDSRDEKNLTEVVKRASDINVEIFVIGVAKKNDPNFEMFHKEMNLIATDPDSEH
VYQFDDFITLQDTLKQKLFKKKCEDFDSYLIQVLGSPALQPGFGTSGEELGESTPEPRKE
ISETVSVSGAEDKENEPPEPTWAGSLATSPSPEAAATEQPEDGTEGVESRIPSPVLNLQP
EKLAHKDPRCLEALKPGNCGEYVVRWYYDKQVNSCARFWFSGCNGSGNRFNSEKECQEIC
VQE
NT seq 3432 nt   +upstreamnt  +downstreamnt
atgtggaacagacattttgtcttctatctcctgcttttgccagcttttatgagccaaaca
atatatggacaaagaaagaaaggatcaaaatccaatttatttgcaaggaaaaatgatctc
caggactctacttgcttcatagatgttgtcttcgttgtggacagctctgaaagttctaaa
attgccctctttgataaacagaaagattttgtgaatagcttgagtgacaaggttttccag
ttgaccccagttggcttcttgaaatacgacatcaaactggcagcgcttcagtttagcagc
tctgtccaaattgatccacctttttcctcttggaaggatctgcagacttttaaacagaag
gtcaagtctatgaatttcattggccaaggcaccttctcttattatgccatctccaatgcc
actatgctacttaagagagaagggcgtaaagatggtgtgaaagtggctttgctgatgacc
gatggcattgaccatccaaagaatccagatgtccagagtatttctgaagatgccagaact
gcaggaatattatttatcaccattggactttccactgtagtcaatgaagccaaacttcgt
ttgatatctggggatccacccagtgaacccattctactgttaagtgatccaacccttgca
gataaaattcgtgatcgcctggatatcttatttgaagagaagtgtgaacagaagatttgt
gaatgtgagaagggggatccaggtgacccagggcctcctggtacacatggaaacccaggt
atcaaaggtgagcgaggaccgaaaggaaatccgggtgatgctcaaaaaggggaacctgga
aaaagaggcccagggggaattcctgggtacaagggtgagaagggggaaaatggagaatgt
ggcaaaccaggaataaaaggtgacaaaggatcgttaggaccacatggaccaaagggaccc
agaggacttcagggcattagtggacctccaggggatccaggcccgaagggatttcaaggc
aataagggtgaaccaggtccccctggtcctgatggtcctccaggagcccctggtattgga
cagcaaggtattaagggggaaagaggtcaggaaggaagaacaggggcaccaggaccaatc
ggcattggtgagccaggccagccaggtccccgtggtcctgagggagcaccaggagagagg
ggcttaccaggagaaggatttccagggccaaagggtgaaaaaggctctgaaggaccaatt
ggcccgcaaggattacaaggcctgtcaatcaaaggggacaagggagatttgggacctgtg
ggaccccaaggcccaatgggtgtccctggaattgggagtcaaggggaacagggaatccaa
ggtcctatgggtccacctggtccacaagggcctccaggacaaggcctacctggttctaag
ggtgaagtaggccagacaggagctacgggtcctagagggccagtaggagttggagtacaa
ggcccaaagggggagccaggctcaatagggctcccaggacaaccaggagtaccaggagag
gatggagctgcagggaagaagggagaagcagggcttccagggacaagaggcccagaagga
ccacctggaaaaggacaacctggctccaagggtgatgaaggaaagaaagggagcaaagga
aatcatggacagaggggatttccagggcctgaaggtccaaagggtgaaccaggaatcatg
ggcccttttgggatgcctggagcatcaattccggggccacctgggccaaagggagacaga
ggaggaccagggatgcctggatttaaaggagaacctggaattgctattcgaggaccaaag
ggggcccaaggacctcggggacccatgggtgctccaggactcaaaggtgatggctacccc
ggtgtggctggacctcggggactaccaggaccccctggaccaatgggtttgcgtggagtg
ggggacacgggagcaaagggagagcctggtgtcagaggccccccaggcccctctgggcct
cggggcataggaacccaagggccaaagggagatattgggcagaaaggcctgcctggccct
cctggaccccctggctacggattacaaggaattaaaggggagcaaggacctcaaggcttt
ccagggccaaagggcatgacaggccgtgggctccctggccagaagggagagcatggagaa
cagggcactgtgggaaagaaaggcgataaaggagaaattggggagcctggatccccagga
agacaggggttacaaggaccaaagggagacataggacttacaagagaagaagttatcaaa
attatttttgaaatatgtggttgtgggcccaaatgcaaagagactcctctagaactgatg
tttgtgattgacagctcagaaagtgtggggctagagaactttgagatcatcaaaagtctc
gtgaagactctgtctgaccaggttgctctggaccttgctacagcccgcataggcataatc
aactatagccataaggtggagaaggtggcccatttgacgcagttctccaacaaggatgac
ttcaagctggctgtggacaacatgcagtatctgggggaaggcacctacacggccacagct
ctccatgaagccaaccacatgtttgaagccgcaaggcccggtgtaaagaaggtggccttg
gtcatcactgatgggcagactgatagccgagatgaaaagaatctgacggaagtggtgaag
agagccagtgacatcaacgtggaaatatttgtgattggggtagcgaagaaaaatgatcca
aactttgaaatgttccacaaagaaatgaatctaattgccactgacccagatagtgagcat
gtttatcagtttgatgacttcattaccctgcaagacaccttgaagcaaaaattgtttaaa
aaaaagtgtgaggattttgattcctacctcattcaagttttgggttcaccggcacttcaa
cctggatttgggacatcaggggaagaacttggtgaatccactccagagcctcggaaggaa
atttcagagactgtcagtgtctctggagctgaggacaaagagaatgagcctccagagcct
acctgggctggcagcctggccaccagtccttcacctgaggctgctgccaccgagcagcca
gaagatgggacagagggtgtcgaatccagaattccaagtcctgttttgaacttacagcca
gaaaagttggcgcacaaagatcctagatgcttggaagccctaaagccaggaaactgtgga
gaatacgtggttcgatggtattatgacaaacaggtcaactcctgcgcccgcttttggttc
agtggctgtaatggctcaggaaatagattcaacagtgaaaaggagtgtcaagaaatctgt
gttcaagaatga

DBGET integrated database retrieval system