KEGG   Canis familiaris (dog): 482463Help
Entry
482463            CDS       T01007                                 

Gene name
NT5C1A
Definition
(RefSeq) cytosolic 5'-nucleotidase 1A
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00230  Purine metabolism
cfa00240  Pyrimidine metabolism
cfa00760  Nicotinate and nicotinamide metabolism
cfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    482463 (NT5C1A)
   00240 Pyrimidine metabolism
    482463 (NT5C1A)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    482463 (NT5C1A)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     482463 (NT5C1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 5-nucleotidase
Motif
Other DBs
NCBI-GeneID: 482463
NCBI-ProteinID: XP_539580
Ensembl: ENSCAFG00000003068
VGNC: 43995
UniProt: F1Q3K8
Position
15
AA seq 365 aa AA seqDB search
MEPGEPRAPREPGPGAETAAAPGWEESKTFYDNLAPKKKPKSPKPQNAVTIAVSSRALFR
MDEEQRIYTEQGVEEYVRYQLEHENEPFSPGPAFPFVKALEAVNRRLRELYPESEDIFDI
VLVTNNHAQVGVRLINSINHYDLFIERFCMTGGNSPICYLKAYHTNLYLSADAEKVREAI
DEGIAAATIFSPSRDVAVSQSQLRVAFDGDAVLFSDESERIVKAHGLDRFFEHEKAHENK
PLAQGPLKGFLEALGRLQKKFYSKGLRLECPIRTYLVTARSAASSGARALKTLRSWGLET
DEALFLAGAPKGPLLEKIRPHIFFDDQMFHVAGAQEMGTVAAHVPYGVAQTPKQTAAMKQ
AASAP
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggaacccggggagccccgggcgccccgcgagcccggcccgggggcagagaccgcggcg
gccccgggctgggaggagagcaagactttctacgacaacctcgcgcccaagaagaaaccc
aaatcgcccaagccccagaatgctgtcaccattgctgtgtcctcccgagccttgttccgc
atggatgaggagcagcgcatctacacggagcagggcgtggaagagtatgtgcgctaccag
ctggaacacgagaacgagcccttcagccccgggccagccttcccctttgtgaaggctctg
gaggctgtgaacagaaggctgcgggagctgtaccccgagagtgaggacatcttcgacatc
gtcctcgtcaccaacaaccacgctcaagtgggtgtccgtctcatcaacagtatcaaccac
tacgacctgttcatcgagcggttctgcatgacaggtgggaatagccccatctgctacctc
aaggcctatcacaccaacctctacttgtcagctgatgcagaaaaagtgcgggaagctatc
gatgaagggatcgccgctgccaccatcttcagccccagcagggacgtggctgtgtcccag
agccagctgcgcgtggccttcgacggggatgctgtgctcttctccgatgagtcggagcgc
atcgtcaaagcccacgggctggacagattctttgagcatgagaaggcccacgagaataaa
cctttggctcagggccccttgaagggctttctggaggcactgggtaggctgcagaagaag
ttttactccaagggcctgcggctggagtgtccaatccgcacctacttggtgacagcgcgc
agcgcagccagttctggggcccgagctctcaagacgctgcgcagctgggggctggagacg
gatgaggctttattcctggcaggagcacccaagggccccctcctggagaagatccgccca
cacatcttctttgatgaccagatgttccatgtggccggggctcaggagatgggcactgtg
gccgcccatgtgccttatggtgtggcacagacacccaagcagacggcggctatgaagcag
gccgcatctgcaccgtag

DBGET integrated database retrieval system