KEGG   Canis familiaris (dog): 482535Help
Entry
482535            CDS       T01007                                 

Gene name
TIE1
Definition
(RefSeq) tyrosine-protein kinase receptor Tie-1
  KO
K05120  tyrosine kinase receptor 1 [EC:2.7.10.1]
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfa01001]
    482535 (TIE1)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     482535 (TIE1)
Protein kinases [BR:cfa01001]
 Receptor tyrosine kinases (RTK)
  TIE family
   482535 (TIE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase fn3 ig Pur_ac_phosph_N I-set Ig_3 Ig_2 hEGF EGF_2 Pkinase_fungal Haspin_kinase TadZ_N DUF4702 C2-set
Motif
Other DBs
NCBI-GeneID: 482535
NCBI-ProteinID: XP_539652
Ensembl: ENSCAFG00000005288
VGNC: 47366
UniProt: E2QXM1
Position
15
AA seq 1138 aa AA seqDB search
MVWLGLPLLLPILFLASHVGAAVDLTLLADLRLVEPQRFFLTCVSGEAGPGRGAEAWAPP
LLLEKDDRIVRTPPGQPPHLLRNGSHSVTLRGFSQPSDLVGVFSCVGGAGPGRTRVLYVH
NSPGAHLLPDKVTHTVNKGDTAVLAARVHKEKQTDVIWKSNGSYFYTLDWHEAQDGHFLL
QLPNVQPPSSGIYSATYLEASPLGSAFFRLIVRGCGAGRWGPDCTKECPGCLHGGVCHDQ
DGECVCPPGFTGTRCEQACREGRFGQSCQEQCPGTSGCRGLTFCLPDPYGCSCGSGWRGS
QCQEACAPGHFGADCRLQCHCRNGGTCDRFSGCVCPSGWHGMHCEKSDRIPQILDLASEL
EFNLETMPRINCAAAGNPFPVRGSMELRKPDGTVLLSTKAIVEPDRTTAEFEVPRLTLGD
SGLWECRVSTSGGQDSRRFRVNVKVPPVPLTPPRLLAKHSRQLVVSPLVSFSGDGPIASV
RLHYRPQDSTMAWSAIVVDPSENVTLMNLRPKTGYSVRVQLSRPGEGGEGAWGPPTLMTT
DCPEPSLQPWLEGWHVEGPDRLRVSWSLPSVPGPLVGDGFLLRLWDGARGQERRENVSSP
QARTALLTGLAPGTQYQLDVRLYHCTLLGPASPPARVLLPPSGPPAPRYLRAQALSDSEI
QLTWLRPEAPAGPISKYIVEVQVAGGSGDPLWMDVDRPEETSTVVRGLNASTRYLFRVRA
SIQGPGDWSTVVEESTLGNGLQSEGPVQEVQAAEEGLDRQLILAVVGSVSATCLTILAAL
LTLVCIRRSCLHRRRTFTYQSGSGEETILQFSSGTLTLTRRPKPQPEPLSYPVLEWEDIT
FEDLIGEGNFGQVIRAMIKKDGLKMNAAIKMLKEYASENDHRDFAGELEVLCKLGHHPNI
INLLGACENRGYLYIAIEYAPYGNLLDFLRKSRVLETDPAFAREHGTASTLSSRQLLRFA
SDAANGMQYLSEKQFIHRDLAARNVLVGENLASKIADFGLSRGEEVYVKKTMGRLPVRWM
AIESLNYSVYTTKSDVWSFGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRMEQPRNCDD
EVYELMRQCWRDRPYERPPFAQIALQLGRMLEARKAYVNMSLFENFTYAGIDATAEEA
NT seq 3417 nt NT seq  +upstreamnt  +downstreamnt
atggtctggctggggctccctttgctgctccccatcctctttctggcttctcatgttggc
gccgcggtggacctgacgctgctggccgacctgcggctcgtggagccccagcgcttcttc
ctgacctgcgtgtccggggaggccgggccgggccggggcgccgaggcctgggcgccgccg
ctgctgctggagaaggacgaccgcatcgtgcgcacgccgcccgggcagcccccgcacctg
ctgcgcaacggctcgcacagcgtcacgctgcggggcttctcgcagccctccgacctcgtg
ggcgtcttctcgtgcgtgggcggcgcgggcccggggcgcacccgcgtcctctacgtgcac
aacagccccggagcgcacctgctcccggacaaggtcacgcacacggtgaacaagggcgac
acggccgtgcttgcggcgcgtgtgcacaaggagaagcagacggatgtgatctggaaaagc
aacggatcctacttctataccctggactggcatgaagcccaggacgggcacttcctgctg
cagctccccaacgtgcagccaccttcgagtggcatctacagtgccacctacctggaagcc
agccccctaggcagcgccttcttcaggctcattgtgcggggctgtggggcagggcgctgg
ggaccagactgtaccaaggaatgccccggctgcctgcacggaggtgtctgccatgaccag
gatggcgagtgtgtgtgtccccctggattcactggtacccgctgcgagcaggcctgcagg
gagggccgttttgggcagagctgccaggagcagtgcccaggcacgtcaggctgccggggt
ctcaccttctgcctcccagacccctacggctgctcttgtggatctggctggagaggaagc
cagtgccaggaagcctgtgcccctggccacttcggggcagattgccgcctccagtgccac
tgtcggaacggtggtacttgtgaccgcttcagtggctgcgtctgtccctccgggtggcac
ggaatgcactgtgagaagtcagaccggatcccgcagatcctggacttggcctcggaactg
gagttcaacttagagaccatgccccggatcaactgtgcagccgcggggaaccccttcccg
gtgcggggcagcatggagctccggaagcccgacggcacggtcctcctgtccaccaaggcc
attgtggagccagacaggaccacagccgagttcgaggtgccccgcttgacccttggggac
agcgggctctgggagtgccgcgtgtccacgtctggtggccaagacagccgacgtttcagg
gtcaacgtcaaagtgcccccggtgcccctgacccctcctcggctcctggccaagcacagc
cgccagctcgtggtctcgccgctggtctccttctccggggacggacccatcgcctccgtc
cgcctgcactaccggccccaggacagcaccatggcctggtcggcgattgtggtggacccc
agtgagaatgtgactttaatgaacctgaggccgaagacaggatacagcgtccgagtgcag
ctgagccggccgggggagggcggggagggggcctgggggcctcccaccctcatgaccacg
gactgtcccgagccctcactgcagccgtggctggagggctggcacgtggagggccctgac
cggctgcgagtgagctggtccttgccctcggtgcccgggccactggtgggcgatggtttc
ctgctgcgcctatgggatggggcacggggacaggagcggcgggagaacgtgtcgtccccc
caggcccgcaccgccctcctgacgggactcgcgccgggcacccagtaccagctggacgtg
cggctgtaccactgcaccctcctgggccccgcctcgccccctgcgcgcgtgcttctgccc
cccagcgggcccccagccccccgctacctccgtgcccaggccctctcagactcagagatc
cagctgacgtggctgcgcccagaggctccggctgggcctatatccaagtacatcgtggag
gtgcaggtggcggggggctcgggagacccgctgtggatggacgtggacaggcccgaggag
accagcacggttgtccgtggccttaacgccagcacacgctacctcttccgtgtgcgggcc
agtatccagggtcccggagactggagcactgtggtggaggagtccaccctgggcaatggt
ctgcagagtgagggcccggtccaagaagtccaggcggctgaggagggcctggaccggcag
ctgatcctggctgtagtaggctctgtgtctgccacctgcctcaccatcctggctgccctg
ctaaccctcgtgtgcatccgcagaagctgcctgcaccgcagacgcaccttcacctaccag
tctggctcgggtgaggaaaccatcctgcagttcagctcaggaaccttgacgctaacccgg
cggccgaaaccacagcccgagcccctgagttatcccgtgctggagtgggaagacatcacc
tttgaggacctcatcggggaggggaactttggccaggtcatccgggccatgatcaagaag
gacgggctcaagatgaatgcggccatcaagatgctgaaagagtacgcctctgaaaatgac
catcgtgacttcgcaggagaactggaagttctgtgcaaactggggcatcaccccaatatc
atcaacctcttgggggcttgtgagaaccgaggttacctgtatatcgctattgaatacgcc
ccctacgggaacctgctagactttctgcggaagagccgggtcttggagacggacccagct
ttcgcccgagagcatggcacggcctccaccctcagctcccggcagctgctgcgttttgcc
agcgatgccgccaacggcatgcagtacctgagtgagaagcagttcatccacagagacctg
gctgcccggaatgtgctggtcggagagaacctggcctccaagattgctgacttcggcctt
tctcggggggaggaggtttatgtgaagaagacaatggggcgtctccccgtgcgctggatg
gccattgagtctctgaattacagcgtctataccaccaagagtgatgtttggtcctttggg
gtcctcctctgggagatcgtgagccttgggggcacaccttactgtggcatgacctgtgct
gagctctatgagaagctgcctcagggctaccgcatggaacagcctcgaaactgtgatgat
gaagtgtacgagctgatgcgtcagtgctggcgggaccgtccgtacgagcgaccccccttt
gcccagattgcgctgcagctgggccggatgctggaagccaggaaggcctacgtgaacatg
tcgctgtttgagaacttcacttacgcgggcatcgacgccacagccgaggaggcctga

DBGET integrated database retrieval system