KEGG   Canis familiaris (dog): 482574Help
Entry
482574            CDS       T01007                                 

Gene name
ZDHHC17
Definition
(RefSeq) palmitoyltransferase ZDHHC17
  KO
K20032  palmitoyltransferase ZDHHC13/17 [EC:2.3.1.225]
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    482574 (ZDHHC17)
Enzymes [BR:cfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     482574 (ZDHHC17)
Membrane trafficking [BR:cfa04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    482574 (ZDHHC17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC Ank_4 Ank_2 Ank_3 Ank_5 Ank
Motif
Other DBs
NCBI-GeneID: 482574
NCBI-ProteinID: XP_005629482
Ensembl: ENSCAFG00000005712
VGNC: 48583
Position
15
AA seq 652 aa AA seqDB search
MGKSQLPARTVEEGPPEFPEVTNKSIYGSQAMMMSDTERRPRAALPGGRRQEIKPQSHYN
HGYGEPLGRKTHIDDYSTWDIVKATQYGIYERCRELVEAGYDVRQPDKENVTLLHWAAIN
NRIDLVKYYISKGAIVDQLGGDLNSTPLHWATRQGHLSMVVQLMKYGADPSLIDGEGCSC
IHLAAQFGHTSIVAYLIAKGQDVDMMDQNGMTPLMWAAYRTHSVDPTRLLLTFNVSVNLG
DKYHKNTALHWAVLAGNTTVISLLLEAGANVDAQNIKGESALDLAKQRKNVWMINHLQEA
RQAKGYDNPSFLRKLKADKEFRQKVMLGTPFLVIWLVGFIADLNIDSWLIKGLMYGGVWA
TVQFLSKSFFDHSMHSALPLGIYLATKFWMYVTWFFWFWNDLNFLFIHLPFLANSVALFY
NFGKSWKSDPGIIKATEEQKKKTIVELAETGSLDLSIFCSTCLIRKPVRSKHCGVCNRCI
AKFDHHCPWVGNCVGAGNHRYFMGYLFFLLFMICWMIYGCISYWGLHCETTYTKDGFWTY
ITQIATCSPWMFWMFLNSVFHFMWVAVLLMCQMYQISCLGITTNERMNARRYKHFKVTTT
SIESPFNHGCVRNIIDFFEFRCCGLFRPVIVDWTRQYTIEYDQISGSGYQLV
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagagccagctgccagctagaactgtagaagagggaccaccagaattcccggaa
gtcacaaataaaagcatctatggcagccaggcaatgatgatgagtgatactgagaggaga
ccgagagcagcgctgccgggaggacggaggcaggaaatcaaaccccaaagccattataac
catggatatggtgaacctcttggacggaaaactcatattgatgattacagcacatgggac
atagtcaaagcaacacaatacggaatatacgaacgctgccgagaattggtggaagcgggt
tatgatgtacggcaaccagacaaagaaaatgttacactcctccattgggctgccatcaat
aacagaatagatttagtcaaatactatatttcgaaaggtgctattgtggatcaacttgga
ggagacctaaattccactccattgcactgggccacaagacaaggccatctatctatggtt
gtgcaactaatgaaatatggtgcagatccttcattaattgatggagaaggatgtagctgt
attcatctggctgctcagtttggacatacctcaattgttgcttatctcatagcaaaagga
caggatgtagatatgatggatcagaatggaatgacacctttaatgtgggcagcttacaga
acgcatagtgtggatccaactagattgcttttaacattcaatgtttcagttaaccttggt
gacaagtatcacaaaaacactgctctgcattgggcagtactagcagggaataccacagtc
attagtcttcttctggaagctggagctaatgttgatgcccagaatatcaagggcgaatca
gcacttgacttggcaaagcagagaaaaaacgtgtggatgatcaaccatttgcaagaggcg
agacaagcgaaaggatatgacaatccttctttccttagaaagctgaaagctgataaggag
tttcggcagaaagtaatgctaggaactccattcctagttatttggctggttgggtttata
gcagacctaaatattgattcttggctcattaaagggctaatgtatggtggtgtttgggct
acagtacaatttctttcaaaatccttttttgatcattcaatgcatagtgcattgcccctt
ggaatatatttggcaaccaaattctggatgtatgtaacgtggttcttctggttttggaat
gatctcaactttttatttatccatcttccattccttgccaatagtgttgcgcttttctac
aattttggaaaatcttggaaatcagatccagggattattaaagctacagaagaacaaaag
aaaaagacaatagttgaacttgcagagacaggaagtctggacctcagtatattctgcagt
acctgtttgatacggaaaccagtgaggtccaaacattgtggtgtgtgcaaccgctgcata
gcaaaatttgatcatcattgcccatgggtgggtaactgtgtaggtgcaggcaaccataga
tactttatgggctacctattcttcttgctttttatgatctgctggatgatttatggttgt
atttcttactggggactccactgtgagaccacttacaccaaggatggattttggacatat
atcactcaaattgctacatgttcaccttggatgttttggatgtttctgaacagtgttttt
catttcatgtgggtggctgtattactcatgtgtcagatgtaccagatatcatgtttaggt
attactacaaatgaaagaatgaatgccagaagatacaagcactttaaagtcacaacaaca
tctattgaaagcccattcaaccatggatgtgtgaggaatattatagacttctttgaattt
cgatgctgtggcctctttcgtcctgttatcgtggactggaccaggcagtatacaatagaa
tatgaccaaatatcaggatctgggtaccagctcgtgtag

DBGET integrated database retrieval system