KEGG   Canis familiaris (dog): 482628Help
Entry
482628            CDS       T01007                                 

Gene name
ASCL1
Definition
(RefSeq) achaete-scute homolog 1
  KO
K09067  achaete-scute complex protein
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cfa03000]
    482628 (ASCL1)
Transcription factors [BR:cfa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Achaete-Scute
    482628 (ASCL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH TFIIA
Motif
Other DBs
NCBI-GeneID: 482628
NCBI-ProteinID: XP_005629354
Ensembl: ENSCAFG00000007324
VGNC: 38173
UniProt: E2R359
Position
15
AA seq 240 aa AA seqDB search
MESPAKMESGGAGPQPQPQPQPQPQPQPQPQPFLPPAACFFATAAAAAAQSAQQQPQPQP
QPQPQQAPQLSPAADGQPSGGGHKSASKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQ
PAAVARRNERERNRVKLVNLGFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDE
HDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggagagccctgccaagatggagagcggcggcgccggcccgcagccgcagccgcagccg
cagccccagccgcagccgcagccccagccgcagcccttcctgccgcccgcagcctgcttc
ttcgccacggcggcggcggcggcggcgcagagcgcgcagcagcagccgcagccgcagccg
cagccgcagccgcagcaggcgccgcagctgagcccggcggcggacggccagccctcaggg
ggcggtcacaagtcagcgtccaagcaagtgaagcgacagcgctcgtcctcgcccgaactg
atgcgctgcaaacggcgcctcaacttcagcggcttcggctacagcctgccgcagcagcag
ccggccgccgtggcgcgccgcaacgagcgcgagcgcaaccgcgtcaagcttgtcaacctg
ggcttcgccaccctgcgggagcacgtccccaacggcgcggccaacaagaagatgagcaag
gtggagacgctgcgctcggcggtcgagtacatacgcgcgctgcagcagctgctggacgaa
cacgacgcggtgagcgccgccttccaggcgggcgtcctgtcgcccaccatctcccccaac
tactccaacgacttgaactccatggccggctcgccggtctcctcctactcgtccgacgag
ggctcctacgaccccctgagccccgaggagcaggagctgctcgacttcaccaactggttc
tga

DBGET integrated database retrieval system