KEGG   Canis familiaris (dog): 482805Help
Entry
482805            CDS       T01007                                 

Gene name
IQCA1L
Definition
(RefSeq) IQ and AAA domain-containing protein 1-like isoform X1
Organism
cfa  Canis familiaris (dog)
SSDB OrthologParalogGFIT
Motif
Pfam: AAA IQ DUF2239 AAA_16 AAA_5 Porph_ging
Motif
Other DBs
NCBI-GeneID: 482805
NCBI-ProteinID: XP_013975265
Ensembl: ENSCAFG00000004812
VGNC: 42073
UniProt: E2R9T2
Position
16
AA seq 828 aa AA seqDB search
MTSSPREVCEVGSMSEQAYQRLWDSSHVTLQELLDQELPLLEPVPDRERQSFHYRLSSLY
LYYLGLLRRFDTLYDQIVHPQKRRLLRRLLDGVAGRVLELKDDLVRTDLSEYHCLDHVLQ
DLKLTPADLEVPIPKYFLLEQSTILKERGLMLAEILSRMGPVTSETSFPEMHRTKAIILL
QRAERARQGRLRATFMREIRKEEERDRKIREEGWHRFSQDQAAIIIQKVWKGYLQRKCTQ
HDRWTEMEFIGMLPSAHQVNLRVMYQDGLGEDIGRLRQIEKEEEFQVAMVKTHDVLRETE
GPDMKEKLKEQIRQWFIECHALTGRFPDYPDESLGGSYLIFADKTPEQVKMELEVQAQES
KKKNQEKNKEKENEKKERKQKKGKGRKREADTMLKAWPSKFIPVINAGHEEYINVWKNQH
ESIHSTQSFDPEALRVEKRKEVEEEIRIQVDELMRQELKNLHLAVDREEGKPLKPPKKKA
GKKTGKKKEKDLTPDRSVESLLEELVVFGFLRKSETVTLKDYIGDFLYLGSTLNLANKLP
MPSLFDIRQNVALYGVLRLGSPDIHAMAPLIRSILLVGPSGMGKKMLVKAVCTETGANLF
DLSPSNLQGKYPGKMGVQMIVHMVFKVARLLQPSVIWIGNAEKNFYKRVPKEEKEMDPKR
IKKDLTKALRLLSPGDRVMLIGTTDQPQLAEMKGLCRTYERILFMPRPDYASRFVLWRQM
IETQGVQVTQNLDISALAKVSDGYTPGHILQAIHSVLTERRVLQLSKQPLVASEFLGHLA
KLEPMYREEEESLKDWYFKTPLGKRKVKFIKDQDVEEAKLAKERKKRK
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atgaccagctcaccaagggaagtgtgcgaagtgggcagcatgtctgagcaagcttaccaa
cgcctctgggattcctcccacgtgaccctgcaagagctgctggaccaagagctgcccctg
ctcgaaccggtgcccgacagggagcgccagtccttccattacaggctgtcgtcgctctac
ctgtactacctggggctgctgcgccggttcgacaccctctacgaccagatagtgcacccg
caaaagcggagattgctgcggcgcctgctggatggcgtggcgggccgcgtgctggagctc
aaggacgacctggtgcgcaccgacttgagcgaataccactgcctggaccacgtgctgcag
gacctcaagcttaccccggcagacctggaggttccaatccccaaatacttcctgctggag
cagtccaccattctgaaggagcgagggctgatgctggcagagatcctgtccagaatggga
ccagtgacctccgagacgagttttccagaaatgcaccggaccaaggccataatcctgctg
caaagggctgagcgggccaggcaaggccggctccgagccaccttcatgcgagagattcgg
aaagaagaggagcgggatcggaagattcgagaggaaggttggcacaggttcagtcaggac
caagcagctatcatcatacagaaggtgtggaagggttacttgcagaggaagtgtactcag
cacgatcggtggacagagatggagttcattggcatgctcccctcggctcaccaggtgaat
ttgcgtgtcatgtatcaagacggcctgggggaagatatcggcaggctccgccaaatagag
aaggaggaggaattccaggtggcaatggtgaagacccatgatgtcctcagggagacagag
gggcctgacatgaaggagaaattgaaggagcaaatccgacagtggtttatcgagtgccat
gcccttactggtcggttccctgattatccagatgaatctttaggtggatcctatctgatc
tttgcagacaagactccagaacaggtaaaaatggaactggaggtgcaggcccaggagagc
aaaaaaaagaaccaagagaaaaataaggaaaaagaaaatgagaaaaaagagaggaaacag
aagaaagggaagggtaggaagagggaagcagacacaatgctgaaagcatggccatccaaa
tttatacctgtgattaatgccggacatgaggagtacataaatgtgtggaagaaccagcat
gagagtatacactcgactcagagttttgaccccgaggcactcagggtggagaagaggaag
gaagtagaggaggagatccggatacaggttgacgagctgatgcgtcaagagctgaagaac
ctgcacctggctgtggacagggaggaggggaaacccttgaagcctccgaagaaaaaggct
gggaagaaaactgggaagaagaaggaaaaagatctgaccccagacaggtccgtggagtct
ctgcttgaagagctcgttgtctttggctttctaaggaagagtgagacggtgaccttaaaa
gactacattggtgacttcctctatctcggatccactctgaacttggcaaacaagttgcct
atgccttccctgtttgacatacgacagaatgtggccctgtatggagtccttcggcttggc
tccccagatatacacgccatggctcccctcatccgctccatcctcctggtgggcccttct
ggcatggggaagaagatgttggtcaaggccgtgtgcacagaaactggtgccaacctgttt
gacctgtcacccagcaacctgcagggcaaatatcctggcaagatgggggtgcagatgata
gtgcatatggtctttaaggtggctcgactcttacagccctctgtgatctggattgggaat
gccgagaagaatttctataagagggtccccaaagaagagaaggagatggacccaaagcga
ataaagaaggatctcaccaaggccctgcgactgctgagcccaggagaccgtgtgatgctg
atagggacgactgaccagccacagctggcagagatgaaggggctgtgccggacctacgag
cgaatcctcttcatgccacggcctgactatgcttctcggtttgtgctctggaggcagatg
atagagacccagggagttcaggtgacccagaacctagacatcagtgccctggccaaggtg
tccgatggctacacacctgggcacattctccaagccatccactcagtgctgaccgagcgg
cgggtcctgcagttgtccaagcagcccctggtggcctcagagttcctgggccatctggcc
aagctggagccaatgtacagggaggaggaggagtccctgaaggactggtacttcaagacg
ccattgggcaagaggaaggtaaaattcatcaaggaccaggatgttgaggaagccaaactg
gcaaaggagaggaagaaaaggaagtga

DBGET integrated database retrieval system